KEGG   Vulpes vulpes (red fox): 112925820
Entry
112925820         CDS       T05911                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04144  Endocytosis
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04520  Adherens junction
vvp04540  Gap junction
vvp04630  JAK-STAT signaling pathway
vvp04810  Regulation of actin cytoskeleton
vvp04912  GnRH signaling pathway
vvp04915  Estrogen signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04926  Relaxin signaling pathway
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04934  Cushing syndrome
vvp05160  Hepatitis C
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112925820 (EGFR)
   04012 ErbB signaling pathway
    112925820 (EGFR)
   04014 Ras signaling pathway
    112925820 (EGFR)
   04015 Rap1 signaling pathway
    112925820 (EGFR)
   04630 JAK-STAT signaling pathway
    112925820 (EGFR)
   04066 HIF-1 signaling pathway
    112925820 (EGFR)
   04068 FoxO signaling pathway
    112925820 (EGFR)
   04020 Calcium signaling pathway
    112925820 (EGFR)
   04072 Phospholipase D signaling pathway
    112925820 (EGFR)
   04151 PI3K-Akt signaling pathway
    112925820 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112925820 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112925820 (EGFR)
   04520 Adherens junction
    112925820 (EGFR)
   04540 Gap junction
    112925820 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112925820 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    112925820 (EGFR)
   04915 Estrogen signaling pathway
    112925820 (EGFR)
   04921 Oxytocin signaling pathway
    112925820 (EGFR)
   04926 Relaxin signaling pathway
    112925820 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    112925820 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112925820 (EGFR)
   05206 MicroRNAs in cancer
    112925820 (EGFR)
   05205 Proteoglycans in cancer
    112925820 (EGFR)
   05230 Central carbon metabolism in cancer
    112925820 (EGFR)
   05231 Choline metabolism in cancer
    112925820 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112925820 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112925820 (EGFR)
   05212 Pancreatic cancer
    112925820 (EGFR)
   05225 Hepatocellular carcinoma
    112925820 (EGFR)
   05226 Gastric cancer
    112925820 (EGFR)
   05214 Glioma
    112925820 (EGFR)
   05218 Melanoma
    112925820 (EGFR)
   05219 Bladder cancer
    112925820 (EGFR)
   05215 Prostate cancer
    112925820 (EGFR)
   05213 Endometrial cancer
    112925820 (EGFR)
   05224 Breast cancer
    112925820 (EGFR)
   05223 Non-small cell lung cancer
    112925820 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112925820 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112925820 (EGFR)
   05171 Coronavirus disease - COVID-19
    112925820 (EGFR)
   05163 Human cytomegalovirus infection
    112925820 (EGFR)
   05165 Human papillomavirus infection
    112925820 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112925820 (EGFR)
   01522 Endocrine resistance
    112925820 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112925820 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112925820 (EGFR)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112925820 (EGFR)
Protein kinases [BR:vvp01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   112925820 (EGFR)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112925820 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   112925820 (EGFR)
  Exosomal proteins of bladder cancer cells
   112925820 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH Borrelia_P83 Kdo
Other DBs
NCBI-GeneID: 112925820
NCBI-ProteinID: XP_025862449
UniProt: A0A3Q7SKW1
LinkDB
Position
Unknown
AA seq 1154 aa
MFNNCEVVLGNLEITYMQRNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLY
ENTHALSVLSNYGSNKTGLQELPLRNLHEILQGSVRFSNNPVLCNVETIQWQDIVDNDFI
SNMSMDIQNHAGRCQKCDPSCPSGSCWGPGKENCQKLTKIICAQQCSGRCRGRSPSDCCH
NQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVK
KCPRNYVVTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINA
TNIKHFRNCTSISGDLHILPVAFRGDSFTHTLPLDPKELDILKTVKEITGFLLIQAWPEN
RTDLHAFENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRKLCYAN
TINWKKLFGTSSQKTKIINNKDEKACKAIGHVCHPLCSSEGCWGPGPSDCVSCRSVRRGK
ECVEKCNVLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIKCAHYVDGPHCIK
VCPAGIMGENNTLIWKFSDSSHVCHLCHPNCTYGCEGPGLEGCAKPGPRIPSIATGIVGG
LLLVVVVALGVGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH
VCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRL
VHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTH
QSDVWSYGVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDA
DEYLIPQQGFFHSPSTSRTPLLSSLSATSNSSTVACIDRNGTCPLKEDSFLQRYSSDPTG
TLTEDNIDDTFLPAPEYINQSVPKRPAGSVQNPVYHNQPLNPAPARDPHYQNPHSNAVDN
PEYLNTHPTCVNSVLDGPSLWTQEANHQISLDNPDYQQDFFPKEAKSNGIFKGPAAENAD
YLRVAPPSSEFIGA
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgttcaataactgtgaggtggtcctggggaatttggaaattacctacatgcaaaggaat
tatgacctttccttcttaaagaccatccaggaagttgccgggtatgtattgattgccctc
aacacggtggagaagattcctttggaaaacctgcagatcatccgaggaaatgtgctctat
gaaaacacccatgctttatccgtcctctccaactatggctcaaataaaactggactgcag
gagcttcccctgagaaacttgcatgaaatactacaaggctctgtgcgcttcagcaataac
cctgtcctctgcaacgtggaaaccatccagtggcaggacatcgttgacaacgattttata
agcaacatgtcgatggacatccagaaccatgcgggcaggtgccaaaagtgtgatccaagc
tgtcccagtggaagttgctggggtccgggaaaggagaattgccagaaactgaccaaaatc
atctgtgcccagcagtgttcggggcgctgtcgcggcaggtcccccagcgactgctgccac
aaccagtgtgccgccggctgcacggggccccgcgagagcgactgcctggtctgccgcaag
ttccgggatgaagccacgtgcaaggacacctgcccgcccctcatgctttacaaccccacc
acctaccaaatggacgtcaacccagagggaaaatacagctttggtgccacctgcgtgaag
aaatgcccccgcaactacgtggtgacagaccatggttcatgtgtccgcgcctgcagctct
gacagctacgaggtggaggaggatggtgtccgcaagtgtaagaagtgtgaggggccttgt
cgcaaagtttgtaatggaatagggattggtgagttcaaagacacactttccataaatgct
acaaacattaaacacttcagaaactgcacgtcgatcagtggagaccttcatatcttgccg
gtcgcatttagaggtgactccttcacgcatacgctacctctagatccgaaggagctggat
atcctgaaaaccgtcaaggaaataacagggtttttgctgattcaggcctggcccgaaaac
aggactgacctccatgccttcgagaacctagaaatcatacgtggaagaacaaagcaacat
ggtcagttttctctggcggtcgtcggcctgaacataacgtccttgggattacgctccctc
aaggagataagtgatggagatgtgatcatctctggaaaccgaaaattgtgctatgcaaat
acaataaactggaagaaactctttgggacttcaagtcagaaaaccaagattataaacaac
aaagatgaaaaagcctgcaaggccataggccacgtctgccatccattgtgctcctcagaa
ggctgctggggcccagggccgagtgactgtgtgtcctgccgaagcgtcaggcgtggcaag
gaatgcgtggaaaagtgcaacgttctggagggggagccaagggagtttgtggagaattcg
gagtgcatacagtgccatccggaatgcctgccccaggccatgaacataacctgcacagga
cgggggcctgacaactgcatcaagtgcgcccactacgtcgatggccctcactgcatcaag
gtctgcccggctggcatcatgggagaaaacaacaccctgatctggaagttttcggatagc
agccacgtgtgccacctgtgccatccaaactgcacctatggctgtgagggaccaggtctt
gaaggctgtgcaaaacctggacccaggatcccatccattgctaccgggattgtcggcggc
ctcctcttggtggtggtggtggcccttggagtgggcctctttttgcgccggcgccacatt
gtccggaagcgcacacttcgcagactgctgcaagaaagagagcttgtcgagcctcttaca
cccagcggagaagctcccaaccaggctctcttgaggatcttaaaggagacggagttcaaa
aagatcaaggtgctgggctctggagcattcggcacagtgtacaagggactctggatccca
gaaggcgagaaggttaaaatccccgtggccatcaaggaattgagagaagccacgtctccc
aaagccaacaaggaaattcttgatgaagcctacgtgatggccagtgtggacaatccccac
gtgtgccgcctcctgggcatctgcctgacgtccacagtgcagctcatcacgcagctcatg
ccctttggctgcctcctggactatgtccgcgagcacaaggacaacatcggctcccagcac
ctgctcaactggtgtgtgcagattgcaaagggcatgaactacctggaagaccggcgcttg
gtgcaccgcgacctggcggccaggaacgtcctggtgaagaccccgcagcacgtcaagatc
acagatttcgggctggccaaactgctgggtgccgaggagaaagagtaccacgcggaagga
ggcaaagtgcctatcaagtggatggctttagaatcgattttacaccgaatttatacccac
caaagcgatgtgtggagctacggcgtcaccgtgtgggagctgatgaccttcgggtccaag
ccttacgacggtatccccgcaagtgagatctccaccatcctggagaagggagagcgcctc
ccgcagccgcccatatgcaccatcgatgtctacatgatcatggtcaagtgctggatgata
gatgcagacagtcgcccaaaattccgtgagttgatcatcgaattctccaaaatggcccga
gacccacagcgctaccttgtcatccagggagatgagaggatgcatttgccaagccctaca
gactccaatttttaccgcgccctgatggacgaggaggacatggaggatgttgtggatgct
gacgagtacctcatcccccagcagggcttcttccacagcccctccacttcccggaccccc
ctcctaagctctctgagcgccaccagcaacagttccaccgtggcttgcatcgaccgaaat
gggacctgtcccctcaaagaagacagcttcttgcagcggtacagctcagaccccactggc
accttgacggaggacaacatagatgacactttcctcccagcacccgaatacataaaccag
tctgttcccaaaaggcctgcgggttctgtccagaatcccgtctatcacaatcagcctcta
aatccagctcctgccagagaccctcactaccaaaatccccacagcaacgcagtggacaac
cctgagtatctcaacacccaccccacctgcgtcaacagtgtcctcgacgggcccagcctc
tggacccaggaggccaaccaccaaatcagcctggacaaccctgactaccagcaggacttc
tttcccaaggaagccaagtccaatggcatttttaagggccctgcagctgaaaatgcagac
tacctgagggtagcgccaccaagcagtgagtttattggagcgtga

DBGET integrated database retrieval system