KEGG   Vulpes vulpes (red fox): 112925961
Entry
112925961         CDS       T05911                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp03440  Homologous recombination
vvp04064  NF-kappa B signaling pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04210  Apoptosis
vvp04218  Cellular senescence
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05202  Transcriptional misregulation in cancer
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    112925961 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112925961 (ATM)
   04068 FoxO signaling pathway
    112925961 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112925961 (ATM)
   04210 Apoptosis
    112925961 (ATM)
   04115 p53 signaling pathway
    112925961 (ATM)
   04218 Cellular senescence
    112925961 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    112925961 (ATM)
   05206 MicroRNAs in cancer
    112925961 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112925961 (ATM)
   05170 Human immunodeficiency virus 1 infection
    112925961 (ATM)
   05165 Human papillomavirus infection
    112925961 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112925961 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112925961 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vvp03032]
    112925961 (ATM)
   03400 DNA repair and recombination proteins [BR:vvp03400]
    112925961 (ATM)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112925961 (ATM)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   112925961 (ATM)
DNA replication proteins [BR:vvp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     112925961 (ATM)
DNA repair and recombination proteins [BR:vvp03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112925961 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 112925961
NCBI-ProteinID: XP_025862574
UniProt: A0A3Q7SL59
LinkDB
Position
Unknown
AA seq 3056 aa
MSLALNDLLICCRQLEHDRATERRKEVEKFKRLIRDPETIQHLDRHSDSKQSKYLNWDAV
FRFLQKYVQKETECLRTAKPSVSASTQATRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMDTVKDSFNGAVYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYFNLYLKPPQ
DMNRVLVARIIHAVTKGCCSQTDGLNSKFLDFFSKAIQHARQEKSAAGLNHILAAFIIFL
KTLAGNFRIRVCQLGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYMHHPKGAKTQEK
GAYESSKWQSILYNLYDLLINEISHIGSRGKYSSGSRNVAVKENLIELMADICHQVFNED
TRSLEISQSYTTTQREFNDYSVPCKKKKIELGWEVIKDHLQKSQSDFDLVPWLQITTQLI
SKYPSSLPNFELSSLLMILYQLLPQRRHGERTPYVLRCLMEVALCQGKKSNLEGSQKSDL
LKLWSKIWSVTFRGISSEQIQAENFGLLGAIIQGSLIEVDREFWKLFTGSACRPSCPAVC
CLTLAMNICLVPETVRTGAEQNVGEVNRNFSLKELIMKWLLLYQLEDDFEDSSELPPVLH
SNFPHLAVEKILVSLTMKNCKAAMNFLQRVPECEQHQKDEEEPSFSEVEELFLKTTFDKM
GFLTIVKESAVEKQQSTGGLSVHKNLKESLDRYLLGLSEQLLSNYSPETTDAETLIRCSS
LLVGVLGCYCSVSVITEEEAYTSELFQKAKSLMQCAGESITLFKNKTHEESRIVSLRNMM
NLCTSCLCNCMKPSPNKIASRFFLRLLTSKLMNDIADICRSLASFIRKPFDFGEVESMED
DTDDNLMEMEDQSSMNLFSDSPAGNASDANVSGEGQSTIGSMNPLAEEHLSKQDLLFLDM
LKFLCVCVTTAQTSTVSFRAADIRRKLLMLIDSSVLDPSKSLHLHMYLVLLKELPGEEYP
LPMEEVVELLKPLSNVCSLYRRDQDVCKAVLNHIVHIVRNLCQGNMDAENTRDAQGQFLT
VIGAFWHLAKEGKCTFSVRMALVKCLKTLLEADPYSKWAILNVMGKDFPVNEVFPHFLAD
NHHQVSMLAAESINRLFQDMKHGGSSTLLKALPLKLQQTAFENAYLKAQEGMTEVSCRAE
NPELLDEIYNRKSVLLMTVAVVLCCSPVCEKQALFALCKSVKENGLEPHLIKKVLEKVSE
TFGYRCLEDFMASHLDYLVLEWLNLQDTENSLYSFPFILLNYTNVEDFYRSCYKVLIPHL
VIRSRFDEVKSIANQIQEDWKSLLTHCFPKILVNILPYFAYECTGDSGMAQQRETATKVY
DMLKDENLLGKQIDHLFLSNLPEIVVELLMTLHEPATSGASQSMDLCDFSGDLDPPPNPP
HFPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQATETNNVYKKHRIL
KIYHLFVTLLLKDIKSALGGAWAFVLRDVIYTLIHYINKRPSRFMDVSLRSFSLCCDLLS
RVCHTAVTYCKDALENHLHVIIGTLIPLVNDQMEVQDQVLDLLKYLVIDNKDNENLYMTI
KLLDPFPDHDVFKDLRITQQKIKYSNGPFSLLEEINHFLSVSVYDALPLTRLEGLKDVCR
QLAQHKDQMADLMRASQDNPQDGIMVKLIVSLLQLCKMAVNHTGEREVLEAVGSCLGEVG
PVDFSTIALQHSRDISSIKASELFEDKELQWTFITLTYLNNTLVEDCVKVRSAAVTCLKS
ILATKTGHSFWEIYKTTTDPMLIYLQPFRTSRKKFLEVPRLDKESPLEGLDDTSLWIPQS
ENHDIWIKRLTCAFLDSGGTKSEILQLLKPMCEVKADFCQTVLPYLIHDILLQDTNESWR
NLLSTQIQGFFTNCFRHSSPTSRSTTPANLDSESEHFFRFCVDKKSQRTMLAVVDYMRRQ
KRPSIGTVFDDAFWLELNYLEVAKVAQSCAAHFTALFYAEIYADKKSMEEDKRSLTFEEA
SQNTAISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRLRTYEHEA
MWGKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSIYLKGLDHENKECCAELQELHY
QAAWRNMQWEHCISVNKGTEGTSYHESLYNALQSLRDREFSTFYESLRYARVKEVEELCK
GGLESVYSLYPTLSRLQAIGELENIGQLLSRSVTDRQPSEVYTKWRKHSQLLKDSDFSFQ
EPIMALRTVILEILMEKEMETSQRECFRDILTKHLVELSILARTAKNTQLPERAIFQIKQ
YNPASCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAQNDPDLSLLYTECLRV
CGTWLAETCLENPAVIMQTYLEKAVEVARNYDGESSDELRNGKMKAFLSLARFSDTQYQR
IENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALRALKEDRK
RFLCKAVENYISCLLSGEGHDMWIFRLCSLWLENSGVPEVNGMMKRDGMKIPSYKFLPLM
YQLAARMGTKMMGGLGFHEVLNNLISRISMEHPHHTLFIILALANANKDEFLTKPEAARR
SRITKNAPKQNSQLDEDRTEAANRIIHTIRSRRPHMVRSVEALCDAYIILANLDAAQWKT
QRKGINIPADQPITKLKNLEDVVVPTMEIKVDPTGEYRNLVTVQSFKAEFRLAGGLNLPK
IIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVPL
SQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDLSALHCQKKMMDVQKKSFEEKYETF
MDICQKFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINE
QSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRS
SQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRLEDDTELHSTPSGDDQECKRSLSDSDQ
SFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9171 nt   +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcaactagaacatgatagagct
acagaacgaaggaaagaagttgagaaattcaagcgcctgattcgggatcctgaaactatt
caacatttagatcggcattcagattccaaacaaagcaaatatttgaattgggatgctgtt
tttagatttttacagaaatatgttcagaaagaaacagaatgtctgcgaacagcaaaacca
agtgtgtcagcctcaacacaagccactaggcagaaaaagatgcaagaaatcagtagtttg
gtcaaatattttatcaaatgtgcaaataaaagagcgcccagactaaaatgtcaagaactc
ttgaactatatcatggatacagtgaaagattcatttaatggtgccgtttatggagctgac
tgtagcaacattctgctcaaggacattctttcagtgaggaaatactggtgtgaaatatct
cagcaacagtggctagaattgttctctgtgtacttcaatctataccttaaacctccacaa
gacatgaatagagttttagtggctagaatcattcatgctgtgactaaaggatgctgttcg
caaactgatggattaaattccaaatttttggatttcttttccaaggctattcagcatgcc
agacaggaaaagagcgccgcaggtctaaatcacatcttagcagcgtttatcatcttcctc
aagacattggctggtaactttcgaattcgagtgtgtcaattaggagatgaaattcttcct
accttgctttatatttggactcaacatagacttaatgattccttaaaagaagtaattatt
gaattatttcaactacaaatttatatgcatcatccaaagggagccaaaacccaagaaaaa
ggtgcttatgaatcaagtaaatggcaaagtatcttatataacttgtatgatctgctaatt
aatgagataagtcatataggaagcagagggaaatattcttcaggctctcgtaatgttgct
gtcaaggaaaacttgattgagttgatggcagatatttgtcaccaggtctttaatgaagat
actagatctctggagatttctcagtcttacactaccacacaaagagaatttaatgattac
agtgtaccttgcaaaaagaagaaaatagaattaggctgggaagtaataaaagatcatctt
cagaagtcacagagtgattttgatcttgtgccttggttacagattacaacccagttaata
tcaaaatacccttcaagcttgcctaactttgagttgtcatcattactgatgatactatac
cagcttctacctcaacgacgacatggggagcgcaccccgtatgtgttacgatgcctcatg
gaagttgcattgtgtcaaggcaaaaagtcaaacttagaaggctcacagaaatcagatttg
ttgaaactctggagtaaaatttggtctgttacctttcgtggtataagttctgaacaaata
caagctgaaaactttggtttacttggagctataattcaaggcagtttaattgaggttgat
agagaattctggaagttatttactgggtcagcctgcagaccttcatgtcctgcagtatgc
tgcttgactctggcaatgaacatctgtttggttccagaaactgtaagaacaggagcggag
cagaatgtaggtgaagtaaatagaaatttttctttgaaggaattgataatgaaatggctc
ttactctatcagttagaggatgactttgaagatagttcagagctgcctccagttcttcac
agtaattttcctcatcttgcagtggagaaaattcttgtgagtctcactatgaaaaattgt
aaagctgcaatgaattttctccaaagagtgccagaatgtgaacagcaccaaaaagatgaa
gaagagccttcgttctcagaagttgaagaactgtttcttaagacaacttttgacaagatg
ggttttttaaccatcgtgaaagaatctgctgtagagaagcagcagtccactggaggcctt
tctgtccacaaaaatctcaaggaatctctggatcgctatctcctgggattatcagaacag
ctcttaagtaactactcacctgagactacagatgcagagacgcttatccggtgttcaagt
cttttggtgggtgttctcggctgctattgctctgtaagtgtaataacagaagaggaggca
tatacatcagaactattccagaaagccaagtctctgatgcagtgtgcaggagaaagtatc
actctgtttaaaaacaagacacatgaggaatctaggattgtttcactgagaaatatgatg
aatctctgtactagttgcttgtgtaactgtatgaagcccagtccaaataagatagcatct
cgatttttcctacgattgttgacatcaaagctaatgaatgatattgcagatatatgtaga
agtttggcgtcctttatcagaaagccatttgactttggagaagtagaatcaatggaagac
gatactgatgacaatctgatggagatggaagatcagtcatccatgaatctattcagtgat
tcccctgctggcaatgctagtgatgcaaatgtatctggagagggccagagtactattggt
tccatgaatcctttagctgaagaacatctgtcaaagcaagatctgcttttcttagacatg
ctcaagttcttgtgtgtgtgtgtaactactgctcagaccagcactgtgtcatttagagca
gctgacattcggaggaaattgttaatgttaattgattctagcgtgctcgaccctagtaaa
tctctccatctgcacatgtatctagtgcttttgaaggagcttcctggagaagaatatcct
ttgccaatggaagaggttgttgaacttctaaaaccactatccaatgtgtgttctttgtat
cgacgtgaccaggatgtttgtaaggcagttttaaaccacattgttcatatagtgaggaac
ctgtgtcaaggcaatatggatgctgaaaacacaagggatgctcaagggcagtttctaaca
gtgattggagcattttggcacttagcaaaagagggaaaatgcactttctctgtaagaatg
gcactagtaaaatgccttaaaactttgcttgaggctgatccttattcaaaatgggctatt
cttaatgtgatgggaaaagacttccctgtaaatgaagtatttccacattttcttgctgat
aatcatcatcaagttagcatgttggctgcagagtcaatcaataggttattccaggatatg
aaacatggaggttcttccacattattgaaggcacttcctttgaagcttcagcagacagct
tttgaaaatgcgtacttgaaagctcaggaaggaatgacagaagtgtcctgcagagctgag
aaccctgaacttttggatgaaatttataacagaaaatctgttttactgatgacagtagct
gtggttttatgctgtagccctgtctgtgaaaaacaggctttgttcgcactgtgcaagtct
gtgaaagagaatggattagaacctcacctcattaaaaaggttttagagaaggtttctgaa
acttttggatatagatgtttagaagacttcatggcttctcatttggattatctggttttg
gaatggctaaatcttcaagatactgaaaatagcttatattctttcccttttattttacta
aactacacaaatgttgaggacttctatagatcatgttacaaggttttgatcccacatctg
gtgattagaagtcgttttgatgaggtgaagtccattgctaatcagattcaagaggattgg
aaaagtcttctaacacactgctttccaaagattcttgtaaatattcttccttactttgcc
tatgagtgtacaggagatagtgggatggcacagcagagagagacagctaccaaagtctat
gatatgcttaaagatgaaaacttactaggaaaacagattgatcatttattccttagtaac
ttaccggagattgttgtggagttgttgatgaccttacatgaaccagcaacttctggtgcc
agccagagcatggacctctgtgacttttcaggggatttggatcctcctcctaatccacct
cattttccatcacatgtgattaaagcaacatttgcctatatcagcaattgccataaaacc
aagcttaaaagcattttggaaattctttccaaaagtcctgattcctatcagaaaattctc
ctagccatatgtgagcaagccactgagacaaataatgtttataaaaagcacagaattctt
aaaatatatcacctgtttgttactttattactgaaagatataaaaagtgccttaggagga
gcctgggcctttgttcttcgagatgttatctatactttgattcattatatcaacaaaagg
ccttctcgtttcatggatgtgtcgttacggagcttctccctgtgttgtgacctgttaagc
cgggtttgccacacagcagtcacttactgtaaggatgctctagaaaatcatcttcatgtc
atcatcggtacacttatacccctagtgaatgatcagatggaagttcaggaccaggtattg
gacttgttgaaatacttagtgatagataacaaggataatgaaaacctctatatgacaatt
aaacttttagatccttttcctgaccatgatgtctttaaggatttgcgcattactcagcag
aaaattaagtacagtaatggacccttttcacttttggaggaaataaaccattttctctcg
gtgagtgtttatgatgcactccctttgacaaggcttgaaggcttgaaggatgtctgcaga
cagctcgcacagcataaggaccagatggcagacctcatgagagcatctcaggataacccg
caggatggcataatggtgaagctcattgtcagcttgttgcagttatgcaagatggcagtg
aaccacactggtgaaagagaagtattagaggctgttggaagctgcctgggagaagtgggt
cctgtagatttctctacgatagccctacagcatagcagagatatatcttctatcaaggcc
tctgagttatttgaagataaagaacttcagtggaccttcatcacattgacctacctgaat
aacacactggtagaagattgtgtcaaagtacgatcagctgctgttacctgtttgaagagc
attttagccacaaagactggacatagtttctgggagatttataagacgacgactgacccc
atgctgatctatctacagccttttagaacatcgagaaaaaagtttttagaagtacccaga
ctggataaagaaagtcctttagaaggcctggatgatacaagcctgtggattccccaaagt
gaaaatcatgacatttggattaaaaggctgacttgtgcttttttggatagtggaggcacg
aaaagtgaaattcttcaattattaaagccaatgtgtgaagtgaaagctgacttttgtcag
actgtgcttccatacttgattcatgatattttactgcaagatacaaatgaatcctggaga
aacctgctttctacacagattcagggattcttcactaattgtttcagacactcctcacca
acgagccgatccacaacccctgcaaatttggattctgagtcagagcattttttccgattc
tgtgtggataaaaaatcacaaagaacaatgctggctgtcgtggactacatgaggagacag
aagagaccttccataggaacagttttcgatgatgctttctggctggagttgaattatcta
gaagttgctaaggtagctcagtcctgtgccgctcactttacagcattgttctatgcagaa
atctacgcagataagaaaagcatggaagaagacaaaagaagtcttacgtttgaagaagca
agccagaatacagctatttctagtttgagtgaaaaaagtaaagaagaaactggaataagt
ttacaggatctgcttttagaaatctacagaagtataggagagccagacagtctgtatggc
tgtggcggagggaaaatgttacagccccttactagactgcgtacatacgaacatgaagca
atgtgggggaaagccctggtgacctatgaccttgagacggcaatctcctcatcaacccgc
caggcaggaataattcaggccttgcagaatttgggactctgccatattctctccatctat
ttaaaaggattagatcatgaaaacaaggagtgctgtgccgagctacaggagctccactac
caagctgcgtggaggaacatgcagtgggagcactgcatttctgtcaacaaaggaacagaa
ggaaccagttaccatgaatcattgtacaatgctctccagtctctaagagatagagaattc
tccacattttatgaaagtctcagatatgccagggtgaaggaagtggaagagctgtgcaag
ggtggcctcgagtctgtgtactcactctaccccacactcagcaggctgcaggccatcggg
gagctcgaaaacatcgggcagctcctctccagatcagtcactgataggcaaccatccgaa
gtatacacaaagtggcggaaacactcccagcttctcaaagacagtgatttcagtttccag
gagcccatcatggctctccgcacagtcattttggaaatcctgatggaaaaggaaatggag
acctcccagagagaatgttttagggacattcttaccaagcaccttgtagaactttccata
ctggcccgaactgccaagaacactcagctccctgaaagagcaatatttcaaattaaacag
tataatccagcaagttgtggagtctctgagtggcagctggaggaagcacaagtattttgg
gcaaaaaaggagcagagtcttgccctaagtattctcaagcaaatgatcaagaagttggat
gccagttgtgcacagaatgatcccgacctaagccttctgtacacagagtgtctgagggtt
tgtggcacctggttagcagaaacttgcctagaaaaccctgcagtgattatgcagacctat
ctagaaaaggcagtggaagttgctagaaattacgatggagaaagcagtgatgaacttaga
aatggaaaaatgaaagcgtttctctcattagcacggttctcagatacacagtaccagaga
attgaaaactacatgaaatcatcagagtttgaaaacaagcaggctcttttgaaaagggcc
aaagaggaagtgggccttcttagggaacataaaatccagaccaacagatacacagtaaag
gttcagcgggagctggagctggatgaatgtgcactccgtgcactgaaagaggatcgtaaa
cgtttcttatgtaaagcagttgaaaattacatcagttgcttattgagtggagaaggacat
gatatgtggatattccgtctttgttctctctggcttgaaaattccggagttcctgaagtc
aatggcatgatgaagagagatggaatgaagattccatcatacaaatttttgcctctcatg
taccagttggctgccagaatggggaccaaaatgatgggaggcctaggatttcatgaagtc
ctcaataatcttatctctagaatttcaatggagcacccccatcacactttgtttattata
ctggccttagcaaatgcaaacaaagatgaatttttgaccaaaccagaggcagcaagaagg
agtagaataactaaaaatgcacctaaacaaaactctcagctcgatgaggatcgaacagag
gctgcaaacagaataatccacactatcagaagtcggagacctcatatggtcagaagtgtg
gaagcactttgtgatgcttacatcatattagcaaacttagatgccgctcagtggaagact
cagagaaaaggcatcaatatcccagcagaccagccaattactaaactgaagaatttagaa
gatgttgttgttccaactatggaaattaaggtggaccccacaggagaatacagaaatctg
gtgactgtacagtcatttaaagcagaatttcgtttagcaggaggtctaaatttaccgaaa
ataatagactgtttggggtctgatggcaaggaaaggagacagctcgtcaagggccgtgat
gacctgcgacaagacgctgtcatgcagcaggttttccagatgtgtaacacgttactgcag
aggaacacagagaccaggaagaggaagctgactatctgcacgtacaaggtggttccactt
tctcagcgaagcggggttctcgaatggtgcacgggaaccgtccctattggtgagtttctt
gtcaacaacgagaatggtgctcataagagatacaggccaaaggacttgagtgcccttcac
tgccagaagaaaatgatggatgtacaaaaaaagtcttttgaagagaaatatgaaactttc
atggatatctgccaaaaatttcagccagttttccgttacttctgcatggaaaaattcttg
gacccagctgtttggtttgagaagcgactggcttatactcgcagtgtggccacttcctcg
attgttggttacatacttggacttggtgatcgacatgtacagaatatcttgataaatgag
cagtctgcagaacttgtacatatagatttgggagttgcttttgaacagggtaaaatcctc
cctactcctgaaacagttccttttaggctcaccagagatattgtggatgggatgggcatt
actggtgttgaaggcgtcttcagaagatgctgtgagaaaaccatggaggttatgagaagc
tctcaggaaaccctgttaaccattgtggaggttctcctgtacgaccccctgtttgactgg
actatgaatcctctgaaagctttgtatttacagcagaggctggaggatgacactgagctc
cactccactcccagtggagatgaccaggaatgcaaacgcagtctcagtgacagtgaccag
agtttcaacaaagtagcagagcgtgtcttgatgagattacaggagaaactgaaaggagtg
gaagaaggaacggtgctcagtgtggggggacaggtgaatctgctcatacagcaagctatg
gaccccaaaaatctcagccgacttttcccaggatggaaagcgtgggtatga

DBGET integrated database retrieval system