KEGG   Vulpes vulpes (red fox): 112926091
Entry
112926091         CDS       T05911                                 

Gene name
JUN
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04024  cAMP signaling pathway
vvp04137  Mitophagy - animal
vvp04210  Apoptosis
vvp04310  Wnt signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04530  Tight junction
vvp04620  Toll-like receptor signaling pathway
vvp04621  NOD-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04657  IL-17 signaling pathway
vvp04658  Th1 and Th2 cell differentiation
vvp04659  Th17 cell differentiation
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04668  TNF signaling pathway
vvp04722  Neurotrophin signaling pathway
vvp04912  GnRH signaling pathway
vvp04915  Estrogen signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04926  Relaxin signaling pathway
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05030  Cocaine addiction
vvp05031  Amphetamine addiction
vvp05132  Salmonella infection
vvp05133  Pertussis
vvp05135  Yersinia infection
vvp05140  Leishmaniasis
vvp05142  Chagas disease
vvp05161  Hepatitis B
vvp05162  Measles
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05224  Breast cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05321  Inflammatory bowel disease
vvp05323  Rheumatoid arthritis
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112926091 (JUN)
   04012 ErbB signaling pathway
    112926091 (JUN)
   04310 Wnt signaling pathway
    112926091 (JUN)
   04668 TNF signaling pathway
    112926091 (JUN)
   04024 cAMP signaling pathway
    112926091 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    112926091 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    112926091 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112926091 (JUN)
   04530 Tight junction
    112926091 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112926091 (JUN)
   04621 NOD-like receptor signaling pathway
    112926091 (JUN)
   04625 C-type lectin receptor signaling pathway
    112926091 (JUN)
   04660 T cell receptor signaling pathway
    112926091 (JUN)
   04658 Th1 and Th2 cell differentiation
    112926091 (JUN)
   04659 Th17 cell differentiation
    112926091 (JUN)
   04657 IL-17 signaling pathway
    112926091 (JUN)
   04662 B cell receptor signaling pathway
    112926091 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    112926091 (JUN)
   04915 Estrogen signaling pathway
    112926091 (JUN)
   04921 Oxytocin signaling pathway
    112926091 (JUN)
   04926 Relaxin signaling pathway
    112926091 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112926091 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112926091 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112926091 (JUN)
   05203 Viral carcinogenesis
    112926091 (JUN)
   05231 Choline metabolism in cancer
    112926091 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112926091 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112926091 (JUN)
   05211 Renal cell carcinoma
    112926091 (JUN)
   05224 Breast cancer
    112926091 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112926091 (JUN)
   05321 Inflammatory bowel disease
    112926091 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    112926091 (JUN)
   05031 Amphetamine addiction
    112926091 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112926091 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112926091 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112926091 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112926091 (JUN)
   05135 Yersinia infection
    112926091 (JUN)
   05133 Pertussis
    112926091 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112926091 (JUN)
   05170 Human immunodeficiency virus 1 infection
    112926091 (JUN)
   05161 Hepatitis B
    112926091 (JUN)
   05171 Coronavirus disease - COVID-19
    112926091 (JUN)
   05162 Measles
    112926091 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112926091 (JUN)
   05169 Epstein-Barr virus infection
    112926091 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    112926091 (JUN)
   05142 Chagas disease
    112926091 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112926091 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112926091 (JUN)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    112926091 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Jnk-SapK_ap_N Fib_alpha DUF3450
Other DBs
NCBI-GeneID: 112926091
NCBI-ProteinID: XP_025862771
UniProt: A0A3Q7T3E8
LinkDB
Position
Unknown
AA seq 330 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXRAAPAAAXPQQPQQPPQAPHHLPQQLPVQHPRLQALKEEPQTVPEMPGETPP
LSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANML
REQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaccgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctgcag
tcggagagcggcgcctacggctacagcaaccccaagatcctgaagcagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccgcacctgcgggccaagaactcggacctg
ctcacctcgcccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctcatc
atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcctgtgcccc
aagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgcgctggccgag
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnncccgcgcagccccagcagcagccnngccgcagcagccg
cagcagcccccgcaggcgccgcaccacctgccgcagcagctccccgtgcagcacccgcgc
ctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggggagacgccgccc
ctgtcccccatcgacatggagtcgcaagagaggatcaaggccgagaggaagcgcatgagg
aaccgcatagctgcctccaagtgccggaaaaggaagctggagaggatcgcccggctggag
gaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacggccaacatgctc
agggaacaggtggcacagctcaaacagaaagtcatgaaccacgttaacagtgggtgccag
ctcatgctaacgcagcagttgcagacgttttga

DBGET integrated database retrieval system