KEGG   Vulpes vulpes (red fox): 112926216
Entry
112926216         CDS       T05911                                 

Gene name
ZMAT3
Definition
(RefSeq) zinc finger matrin-type protein 3 isoform X1
  KO
K10137  zinc finger, matrin type 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112926216 (ZMAT3)
SSDB
Motif
Pfam: zf-C2H2_jaz zf-met zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 112926216
NCBI-ProteinID: XP_025862979
UniProt: A0A3Q7SLV5
LinkDB
Position
Unknown
AA seq 290 aa
MILLQHAGLPLPKRPSSSPPMSVAARSTGTLQLPPQKPFGQEASLPLAGEEELPKGGEQD
SALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPV
APPAVPVAPQMGSFKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QSNSFSEASEAGQRRTRKEGNEYKMMPNRRNNMYTVQNNSAGPYFNPRSRQRIPRDLAMC
VTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV
NT seq 873 nt   +upstreamnt  +downstreamnt
atgatcctcttgcaacacgccgggcttcctctgcctaagcggccctcatcctctcctcct
atgtcagtggccgccaggtctacaggaaccttgcaacttcctccacagaagccttttggg
caggaggcttccttgcctctggcaggggaagaagagttacctaagggaggggagcaagac
tctgccctggaggagctatgtaagcccctgtactgcaaactctgcaatgttaccttgaac
tcagcgcagcaagcccaagctcattatcagggtaaaaatcatggtaagaaactccgaaat
tactatgcagccaacagttgtcctcctcctgccagaatgagcaatgtggtagaacctgtg
gctcctccagctgttcctgttgctccgcagatgggttcctttaagccaggaggcagagtg
atcctggccacagagaatgattactgtaagctctgtgacgcctcctttagttctccggct
gtggctcaggctcactatcaagggaagaatcatgccaagaggctgcggctggcggaagct
cagagtaactcattctcggaagcctcagaggctggtcagcggcggacccggaaagaaggg
aatgagtataagatgatgcctaataggaggaataatatgtatacagtacagaataattca
gcaggtccttacttcaatccccgctctcggcagagaattccacgagatctggccatgtgt
gttactccaagtggccagttttactgctccatgtgtaatgttggggccggtgaagagatg
gagttccgacagcatttagagagcaagcaacataaaagcaaggtgtctgaacagcggtac
agaaatgagatggagaatctgggatatgtatag

DBGET integrated database retrieval system