KEGG   Vulpes vulpes (red fox): 112927292
Entry
112927292         CDS       T05911                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04024  cAMP signaling pathway
vvp04210  Apoptosis
vvp04380  Osteoclast differentiation
vvp04620  Toll-like receptor signaling pathway
vvp04657  IL-17 signaling pathway
vvp04658  Th1 and Th2 cell differentiation
vvp04659  Th17 cell differentiation
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04668  TNF signaling pathway
vvp04713  Circadian entrainment
vvp04725  Cholinergic synapse
vvp04728  Dopaminergic synapse
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04926  Relaxin signaling pathway
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04932  Non-alcoholic fatty liver disease
vvp04935  Growth hormone synthesis, secretion and action
vvp05031  Amphetamine addiction
vvp05132  Salmonella infection
vvp05133  Pertussis
vvp05135  Yersinia infection
vvp05140  Leishmaniasis
vvp05142  Chagas disease
vvp05161  Hepatitis B
vvp05162  Measles
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05224  Breast cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05323  Rheumatoid arthritis
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112927292 (FOS)
   04668 TNF signaling pathway
    112927292 (FOS)
   04024 cAMP signaling pathway
    112927292 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112927292 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112927292 (FOS)
   04660 T cell receptor signaling pathway
    112927292 (FOS)
   04658 Th1 and Th2 cell differentiation
    112927292 (FOS)
   04659 Th17 cell differentiation
    112927292 (FOS)
   04657 IL-17 signaling pathway
    112927292 (FOS)
   04662 B cell receptor signaling pathway
    112927292 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    112927292 (FOS)
   04917 Prolactin signaling pathway
    112927292 (FOS)
   04921 Oxytocin signaling pathway
    112927292 (FOS)
   04926 Relaxin signaling pathway
    112927292 (FOS)
   04935 Growth hormone synthesis, secretion and action
    112927292 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    112927292 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    112927292 (FOS)
   04728 Dopaminergic synapse
    112927292 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112927292 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112927292 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112927292 (FOS)
   05231 Choline metabolism in cancer
    112927292 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112927292 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112927292 (FOS)
   05224 Breast cancer
    112927292 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112927292 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    112927292 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112927292 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112927292 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112927292 (FOS)
   05135 Yersinia infection
    112927292 (FOS)
   05133 Pertussis
    112927292 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112927292 (FOS)
   05170 Human immunodeficiency virus 1 infection
    112927292 (FOS)
   05161 Hepatitis B
    112927292 (FOS)
   05171 Coronavirus disease - COVID-19
    112927292 (FOS)
   05162 Measles
    112927292 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112927292 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    112927292 (FOS)
   05142 Chagas disease
    112927292 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112927292 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112927292 (FOS)
   04131 Membrane trafficking [BR:vvp04131]
    112927292 (FOS)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    112927292 (FOS)
Membrane trafficking [BR:vvp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    112927292 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 112927292
NCBI-ProteinID: XP_025864414
UniProt: A0A3Q7SPH5
LinkDB
Position
Unknown
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT
LPLLNDPEPKPSVEPVKSIGSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMATEPEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctctggtttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcg
tccccggccggggacaacctctcctactaccactccccggccgactccttctccagcatg
ggctctcccgtcaatgcgcaggacttctgcaccgatctggccgtctccagtgccaacttt
atcccgacggtgaccgccatctccaccagcccggacctgcagtggctggtgcagcccacc
ctggtctcctccgtggccccgtcccagaccagagccccccacccgtatggagtccccacc
ccctcggctggggcttactccagggctggcgtagtgaagaccatgacgggaggcagagct
cagagcattggccggaggggcaaggtggaacagctgtccccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccgcaggagggag
ctgactgacacgctccaagcggagacagaccaactagaagacgagaagtctgctctgcag
accgagatcgccaacctgctgaaggagaaggagaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggcttccccgaagagatgtccgtggcttcc
ctagatctgagcgggggcctgcccgaagctgccaccccggagtccgaggaggctttcacc
ctgcccctcctcaatgatcctgagcccaagccctccgtggagcccgtcaagagcatcggc
agcatggagctgaaggccgagccctttgatgacttcctgtttccagcatcatccaggccc
agcggctcggagaccgcccgctccgtgccagacatggacctgtctggttccttctatgca
gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagccc
gagcctctgtgcacccccgtagtcacctgtactcctagctgcactacctacacgtcttcc
ttcgtcttcacctaccctgaggctgactccttccccagctgtgcggccgctcatcgcaag
ggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system