KEGG   Vulpes vulpes (red fox): 112927357
Entry
112927357         CDS       T05911                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04540  Gap junction
vvp04630  JAK-STAT signaling pathway
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05206  MicroRNAs in cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112927357 (PDGFRB)
   04014 Ras signaling pathway
    112927357 (PDGFRB)
   04015 Rap1 signaling pathway
    112927357 (PDGFRB)
   04630 JAK-STAT signaling pathway
    112927357 (PDGFRB)
   04020 Calcium signaling pathway
    112927357 (PDGFRB)
   04072 Phospholipase D signaling pathway
    112927357 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    112927357 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112927357 (PDGFRB)
   04540 Gap junction
    112927357 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112927357 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112927357 (PDGFRB)
   05206 MicroRNAs in cancer
    112927357 (PDGFRB)
   05230 Central carbon metabolism in cancer
    112927357 (PDGFRB)
   05231 Choline metabolism in cancer
    112927357 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    112927357 (PDGFRB)
   05218 Melanoma
    112927357 (PDGFRB)
   05215 Prostate cancer
    112927357 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112927357 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112927357 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112927357 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:vvp04090]
    112927357 (PDGFRB)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112927357 (PDGFRB)
Protein kinases [BR:vvp01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   112927357 (PDGFRB)
CD molecules [BR:vvp04090]
 Proteins
  112927357 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 112927357
NCBI-ProteinID: XP_025864496
UniProt: A0A3Q7TGC1
LinkDB
Position
Unknown
AA seq 1135 aa
MRGQRGGLPGGGDSPELRTVPTPEGISSKDTMQVPSTMPAPVLKGQALWLPLLLLLSPQA
SGGLVITPPGPELVLNISSTFVLTCSGLAPVVWERLSQEPLQKMARTQDGTFSSTLTLTN
VTGLDTGEYFCTYKGSHGLEPDGRKRLYIFVPDPTMGFLPVDPEELFIFLTEITEITIPC
RVTDPRLVVTLHEKKVDIPLPIPYDHQRGFSGTFEDKTYVCKTTIGDKEVDSEAYYVYSL
QVSSINVSVNAVQTVVRQGENITIMCIVTGNEVVNFEWTYPRMESGRLVEPVTDFLFNVP
SHIRSILHIPSAELGDSGTYICNVSESVNDHRDEKSINVTVVESGYVRLLGELDAVQFAE
LHRSRALQVVFEAYPPPTVVWSKDNRTLGDSSAGEIALTTRNVSETRYVSELTLVRVKVA
EAGYYTMRAFHEDAEAQLSFQLQVNVPVRVLELSESHPASGEQTVRCRGRGMPQPHLTWS
TCSDLKRCPRELPPTPLGNSSEEESQLETNVTYWPEDQEFEVVSTLRLRRVDQPLSVRCT
LHNLLGHDMQEVTVVPHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYEIRWKVI
ESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATM
KVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDL
VDYLHRNKHTFLQLCSDKRRPPSAELYSNALPAGLPLPSHVSLPGESDGGYMDMSKDESV
DYVPMLDMKGGVKYADIESSSYMAPYDNYVPTAPERTCRATLINESPVLSYTDLVGFSYQ
VANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKW
MAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQPAHA
SDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAVLRSQ
ARLPGFPGLRSPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADDGPLESSPSLASSTL
NEVNTSSTISCDSPLEPQEEPEPEPEPQPEPQVVPEPPLDSSCPGPRAEAEDSFL
NT seq 3408 nt   +upstreamnt  +downstreamnt
atgagaggtcagcgaggaggacttcctggagggggtgacagcccagagctcaggactgtg
cccacccccgaaggcatcagcagcaaggacaccatgcaggttccaagcaccatgccagct
cctgtcctcaaaggccaggcactgtggctgccgctgctgttgctgctgagcccacaggcc
tccggcggcctggtcatcacacccccggggccggagcttgtccttaatatctctagcacc
ttcgttctgacctgctcgggtctagctccggtggtatgggaacggttgtcccaagagccc
ctgcagaaaatggccaggacccaagatggcaccttctccagcacactgacactgaccaat
gtcactgggctagacacgggagagtacttttgcacctacaaaggctcccatgggctggag
cctgatgggcgaaaacggctctatatctttgtgccagatcccactatgggctttctcccg
gttgatcctgaggaactcttcatctttctcacggaaataacggagatcacaattccatgc
cgagtgacggatccaagactggtggtgacactacacgagaagaaagtggatatcccactg
cccatcccctatgaccaccaacgtggcttctctggtaccttcgaggacaagacttatgtc
tgcaagaccaccatcggggacaaggaagtggattctgaagcctactatgtttacagcctc
caggtgtcatccatcaatgtctccgtgaatgcagtgcagactgtggtccgccagggtgag
aacatcaccatcatgtgcatcgtgaccggaaatgaggtggttaactttgaatggacatac
ccacgcatggagagtgggcggctggtggagccagtgactgacttcctcttcaatgtgccc
tcccacatacgctccattctgcacatccctagtgctgagcttggcgattcagggacctac
atctgcaatgtatcagaaagtgtgaatgaccatcgagatgaaaagtccatcaatgtcacc
gtggttgagagcggctacgtgcggctgctgggagagctggacgccgtacagttcgcggag
ctgcaccgcagccgggctctgcaggtcgtgttcgaggcctacccgccgcctactgtcgtg
tggtccaaggacaaccgcacgctaggcgactccagcgcaggcgagatcgccttgaccaca
cgcaacgtgtctgagacccggtacgtgtcagaactgacgttggtgcgggtcaaggtggcc
gaggctggctactacaccatgcgggccttccatgaggatgccgaggcccagctctccttc
cagctgcaggtcaatgtgcctgtccgtgtgctggagctgagtgaaagccaccctgccagc
ggggagcagacggtccgctgtcgcggccggggcatgccccagccacacctcacatggtct
acctgcagcgacctcaaaagatgtcctcgagagctgccacccacgccgctagggaacagt
tcagaggaggagagccagctggagactaatgtgacatactggcctgaggatcaggagttc
gaggtggtgagcacgctgcgcctgcgccgtgtggatcagccgctgtcggtgcgctgcact
ctgcacaacctgctgggacacgacatgcaggaggtcaccgtggtgccacattctctgccc
ttcaaggtggtggtgatctcggccatcctggccttggtggtcctcacaatcatctccctc
atcatcctcatcatgctctggcaaaagaagccacgttatgagatccgatggaaggtgatt
gaatccgtgagctccgatggccatgagtacatctacgtggaccctatgcagctgccctac
gactccacctgggagctgccgagggaccagctcgtgcttggacgtacgctcggctctggg
gcctttgggcaggtggtggaggcgacggctcacggcctaagccattctcaggccacgatg
aaagtggcagtcaagatgctgaaatccacagcccgcagcagcgagaagcaggccctcatg
tcagagctgaagatcatgagtcacctcgggccccatctaaatgtggtcaacttgctgggg
gcctgcaccaaaggaggacccatctacatcatcaccgagtactgccgctatggggacctg
gtggactaccttcaccgcaacaagcacaccttcctgcagctctgctccgacaagcgccgc
ccgcccagcgccgagctctacagcaacgccctgcccgcggggctccctctgcccagccac
gtgtctctgcctggggagagtgacgggggctacatggacatgagcaaggacgagtcagtg
gactacgtgcccatgctggacatgaaaggaggcgtcaaatatgcagacattgagtcctcc
agctacatggccccttatgacaactacgtccccactgctcccgagaggacctgtcgggca
actctgatcaatgagtccccagtgcttagctacacggatctcgtgggcttcagctaccag
gtggccaatggcatggagttcctggcctccaagaactgtgtccaccgagatctggcagcc
agaaacgtgctcatctgtgagggcaagctggtcaagatctgtgactttggcctggctcgt
gacatcatgagagactcaaactatatctccaaaggcagcaccttcctgcctctgaagtgg
atggctcccgagagcatcttcaacagcctctataccaccctgagcgacgtgtggtccttt
gggatcctactctgggagatcttcaccctgggtggcacaccttacccagagctgcccatg
aacgaacagttctataatgccatcaagcggggctaccgcatggctcagcctgcccacgcc
tccgacgagatttatgagatcatgcagaagtgctgggaagagaagtttgagatccggcct
cccttctcccagctggtgctgcttctcgagaggctgctgggtgaggggtacaaaaagaag
taccagcaggtggatgaggagtttctgaggagcgaccacccagcagtccttcggtcccaa
gcccgcttgcctggcttccctggcctccgatcccctctggacaccagctctgtcctgtac
actgctgtgcagcccaacgagggtgacaacgactacatcatccccctgccggaccccaag
cctgaggttgctgatgacggcccactggagagttctcccagccttgccagctccaccctg
aatgaagtcaacacctcctctaccatctcctgtgacagccccctggaaccccaagaggag
ccagaaccagagccagagccccagcccgagccccaggtggtgccggagccaccgctggat
tcaagctgccctgggcctcgggctgaggcagaggacagcttcctgtag

DBGET integrated database retrieval system