KEGG   Vulpes vulpes (red fox): 112927455
Entry
112927455         CDS       T05911                                 

Gene name
CSNK1A1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04310  Wnt signaling pathway
vvp04340  Hedgehog signaling pathway
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112927455 (CSNK1A1)
   04340 Hedgehog signaling pathway
    112927455 (CSNK1A1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112927455 (CSNK1A1)
   05226 Gastric cancer
    112927455 (CSNK1A1)
   05224 Breast cancer
    112927455 (CSNK1A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112927455 (CSNK1A1)
   05022 Pathways of neurodegeneration - multiple diseases
    112927455 (CSNK1A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112927455 (CSNK1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112927455 (CSNK1A1)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112927455 (CSNK1A1)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   112927455 (CSNK1A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 112927455
NCBI-ProteinID: XP_025864627
UniProt: A0A3Q7TTN6
LinkDB
Position
Unknown
AA seq 365 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaattcattgtcggagggaaatacaaactggta
cggaagatcgggtctggctccttcggggacatttacctggcgatcaacattaccaacggc
gaggaagtggcagtgaagctagaatctcagaaggccaggcatccccagttgctgtacgag
agcaaactctataagattcttcaaggtggggtgggcatcccccacatacggtggtatggt
caggaaaaagactacaatgtactagtcatggatcttcttggacccagtctcgaagacctc
ttcaatttctgttcaagaaggttcacaatgaaaactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtacttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggacaaggcaacac
ataccatacagagaagataaaaatctcactggcactgcccgatatgctagcatcaatgca
catcttggtattgaacagagtcgccgagatgacatggaatcattaggatatgttttgatg
tattttaatagaaccagcctgccatggcaaggactaaaggctgcaacaaaaaaacaaaaa
tatgaaaagattagtgaaaagaagatgtccactcctgttgaagttttatgtaaggggttt
cctgcagaatttgccatgtacttaaactattgtcgtgggctacgctttgaggaagccccg
gattacatgtatctgaggcagctattccgcattcttttcaggaccctgaaccaccaatat
gactacacatttgattggacaatgttaaagcagaaagcagcacagcaggcagcctcttca
agtgggcagggtcagcaggcccaaacccccacaggcaagcaaactgacaaaaccaagagt
aacatgaaaggtttctaa

DBGET integrated database retrieval system