KEGG   Vulpes vulpes (red fox): 112928464
Entry
112928464         CDS       T05911                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04110  Cell cycle
vvp04114  Oocyte meiosis
vvp04115  p53 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04218  Cellular senescence
vvp04934  Cushing syndrome
vvp05161  Hepatitis B
vvp05162  Measles
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05206  MicroRNAs in cancer
vvp05215  Prostate cancer
vvp05222  Small cell lung cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112928464 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112928464 (CCNE1)
   04114 Oocyte meiosis
    112928464 (CCNE1)
   04115 p53 signaling pathway
    112928464 (CCNE1)
   04218 Cellular senescence
    112928464 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112928464 (CCNE1)
   05206 MicroRNAs in cancer
    112928464 (CCNE1)
   05203 Viral carcinogenesis
    112928464 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    112928464 (CCNE1)
   05215 Prostate cancer
    112928464 (CCNE1)
   05222 Small cell lung cancer
    112928464 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112928464 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112928464 (CCNE1)
   05161 Hepatitis B
    112928464 (CCNE1)
   05162 Measles
    112928464 (CCNE1)
   05169 Epstein-Barr virus infection
    112928464 (CCNE1)
   05165 Human papillomavirus infection
    112928464 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vvp03032]
    112928464 (CCNE1)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112928464 (CCNE1)
DNA replication proteins [BR:vvp03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    112928464 (CCNE1)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112928464 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Connexin50
Other DBs
NCBI-GeneID: 112928464
NCBI-ProteinID: XP_025865978
UniProt: A0A3Q7T8X6
LinkDB
Position
Unknown
AA seq 395 aa
MKDDAGTDVSVRSRKRKANVAVFLQDPDEEVAKIDRTARGLCGGQPWDNNPACENPCSLI
PTPDKEEDEPTYPSSVCGPQSFMPSRASPLPLLNWANRDEVWKIMLNKEKTYLRDKHFMQ
RHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQQNIVKTLLQLIGISS
LFIAAKLEEIYPPKLHQFAYVTDGACSGEEILSMELIIMKALKWHLSPLTIVSWLNVYMQ
VAYLNDLYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFPYGVLAASALYHFSSSELMQK
VSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNIQTHINSLDLLDKAQA
KKAILSEQNRISPPPTGVLTPPQSSKKQSGGQDTA
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaaagacgacgctggcaccgacgtgtctgtgcgctccaggaagaggaaggcaaatgtg
gccgtgtttttgcaggatccggatgaagaagttgcgaaaattgacaggacggcgagaggc
ctgtgcggcggacagccttgggacaataatcccgcatgtgaaaacccctgctccttgatt
cccacacctgacaaagaagaggatgagccaacatacccaagttccgtgtgtggaccgcag
agcttcatgccctccagagcctcgccgctgcctctactgaactgggcaaatagagacgag
gtctggaaaattatgctaaataaggaaaagacatacttacgggataagcactttatgcag
cggcaccccctcctgcagcccaagatgcgagcaattcttctggattggttgatggaggtg
tgcgaagtctataaacttcacagagagacattttacttggcacaggatttctttgatcgg
tatatggcaacgcaacaaaatattgtgaaaacgcttttacagcttattgggatttcatct
ttatttattgctgccaaacttgaggaaatctatcctccaaagctgcaccagtttgcttat
gttacagatggggcatgttcaggagaggagattcttagcatggaattaatcattatgaag
gctcttaagtggcacttaagtcccctgaccattgtatcctggctgaatgtatatatgcag
gttgcatatctaaatgacttatatgaagtgctcctgccacagtatccccagcaaatcttc
atacagatcgcagagcttttggatctttgtgtcctggatgttggctgcttagaatttccc
tacggtgtacttgctgcttctgccttgtatcatttctcttcgtctgaattgatgcaaaag
gtttcagggtatcagtggtgtgatatagagaagtgtgtcaagtggatggtgccgtttgcc
atggtcattagggagacgggaagttcaaaactgaagcacttcaggggagttcccgctgaa
gacgcacacaacatccagacccatataaacagcttggatttgctggacaaagcccaagcc
aagaaagccatattgtctgaacagaatcggatttctccgccccccaccggggtcctcact
cccccgcagagcagcaagaagcagagtggcgggcaggacacggcgtga

KEGG   Vulpes vulpes (red fox): 112931227
Entry
112931227         CDS       T05911                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04110  Cell cycle
vvp04114  Oocyte meiosis
vvp04115  p53 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04218  Cellular senescence
vvp04934  Cushing syndrome
vvp05161  Hepatitis B
vvp05162  Measles
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05206  MicroRNAs in cancer
vvp05215  Prostate cancer
vvp05222  Small cell lung cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112931227 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112931227 (CCNE2)
   04114 Oocyte meiosis
    112931227 (CCNE2)
   04115 p53 signaling pathway
    112931227 (CCNE2)
   04218 Cellular senescence
    112931227 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112931227 (CCNE2)
   05206 MicroRNAs in cancer
    112931227 (CCNE2)
   05203 Viral carcinogenesis
    112931227 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    112931227 (CCNE2)
   05215 Prostate cancer
    112931227 (CCNE2)
   05222 Small cell lung cancer
    112931227 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112931227 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112931227 (CCNE2)
   05161 Hepatitis B
    112931227 (CCNE2)
   05162 Measles
    112931227 (CCNE2)
   05169 Epstein-Barr virus infection
    112931227 (CCNE2)
   05165 Human papillomavirus infection
    112931227 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vvp03032]
    112931227 (CCNE2)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112931227 (CCNE2)
DNA replication proteins [BR:vvp03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    112931227 (CCNE2)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    112931227 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112931227
NCBI-ProteinID: XP_025869582
UniProt: A0A3Q7U8L6
LinkDB
Position
Unknown
AA seq 403 aa
MSRRSRLQAKQQPQPSQTDSPQEAQIIQAKKRKTAQDVKKRKEEVARKQQYEIRNCWPPV
LSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKDVWLNMLKKE
SRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDIN
KNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPV
TVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAVDSLEFQYRILAAAAL
CHFTSVEVVKKASGLEWDNISECVDWMVPFVSVIKSTSPVKLKIFKKISMEDRHNIQTHT
NYLSMLDEVNYVNTFRKGGQLSPVCSGGIMTPPKSTEKPPGKH
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgtccagacgcagccgtttacaagccaagcagcagccacagcccagccagacggactcc
ccccaagaagcccagataatccaggctaagaagaggaaaactgcccaggatgtcaaaaaa
agaaaagaggaggtcgccaggaaacagcagtatgagattaggaattgttggccacctgta
ttatctggggggatcagtccgtgtattatcattgaaacaccccacaaagaaataggaaca
agtgacttctctaggtttacaaattacagatttaaaaatctttttattaatccttcacct
ttgcctgatttaagttggggatgttcaaaggatgtttggctaaacatgcttaaaaaagag
agcagatatgttcacgacaaacattttgaagttctgcattctgacttggagccacagatg
aggtcaatacttctagattggcttttagaggtatgtgaagtatacacacttcatagagaa
acattttacctggcgcaagacttttttgatagatttatgttgacacagaaggatataaat
aaaaatatgctccaactcattggaattacctcattattcattgcttccaaacttgaggaa
atttatgctcctaagctccaagagtttgcttatgtcactgatggtgcctgcagtgaagag
gatatcttaagaatggaacttattatattaaaggctttaaaatgggaactctgtcctgta
acagtcatctcctggctaaatctcttcctccaagttgacgctcttaaagatgctcctaaa
gttcttctacctcagtattctcaggaaaagttcattcaaatagctcagcttttagatctg
tgtattctggccgtcgactcactagagttccagtacagaatactggctgccgctgccctg
tgccattttacctctgttgaggtggttaagaaagcctcaggtttggaatgggacaacatt
tctgaatgtgtagactggatggtgccttttgtcagtgtaataaaaagtactagccccgtg
aagctgaagatttttaagaagatttctatggaagatagacacaatatccagacacataca
aattatctgtctatgctggatgaagtaaactatgtaaacaccttcagaaaggggggacag
ctgtcacccgtgtgcagtggaggcattatgacaccgccgaagagcactgagaaaccacca
ggaaaacactaa

DBGET integrated database retrieval system