KEGG   Vulpes vulpes (red fox): 112929075
Entry
112929075         CDS       T05911                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00860  Porphyrin and chlorophyll metabolism
vvp01100  Metabolic pathways
vvp04066  HIF-1 signaling pathway
vvp04216  Ferroptosis
vvp04978  Mineral absorption
vvp05200  Pathways in cancer
vvp05206  MicroRNAs in cancer
vvp05225  Hepatocellular carcinoma
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    112929075 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112929075 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    112929075 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    112929075 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112929075 (HMOX1)
   05206 MicroRNAs in cancer
    112929075 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112929075 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112929075 (HMOX1)
Enzymes [BR:vvp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     112929075 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 112929075
NCBI-ProteinID: XP_025866739
UniProt: A0A3Q7STR5
LinkDB
Position
Unknown
AA seq 288 aa
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMKNFQKGQVTRKGFKLVMASLYHVYEA
LEEEIEHNRENPVYAPLYFPEELHRKAALERDMAFWYGPRWHEAIPYTQATRRYVQRLQE
VGRKEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGVDFFTFPNIASATKFKQ
LYRSRMNSLEMTPEVRQRVIEEAKTAFLLNIQLFEELQELLSKDTEDQSPSQASGLRQRV
GSRAQDSTPTETPRGKPQLNLPSQAPLLRWVLTLSFLVATVAVGLYVM
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagcgccctcagcccgacagcatgccccaggatctgtcagaggccctgaaggaggcc
accaaggaggtgcatacccaggcggagaatgccgagttcatgaagaactttcagaagggc
caggtgacccgaaaaggctttaagctggttatggcttccctgtaccacgtctatgaggcc
ctggaggaggagattgagcacaacagggagaacccagtctacgcccccctctacttccca
gaagagctgcaccgcaaggccgccctggagagggacatggccttctggtacggcccccgc
tggcacgaggccatcccctacacgcaggccacccgccgctacgtgcagcgcctccaggag
gtggggcgcaaggagccagagctgctggtggcccatgcctacacccgctacctcggtgac
ctgtcagggggccaggtcctcaagaagattgctcagaaggccctggacctgcccagctcc
ggggagggcgtcgacttcttcaccttccccaacatcgccagcgccacgaagttcaagcag
ctgtaccgctcccgcatgaactctctggagatgacgcccgaggtcaggcagagggtcatc
gaagaggccaagactgccttcctgctgaacattcagctgtttgaggagctgcaggagctg
ctgagcaaggacactgaggaccagagcccctcgcaggcctcagggctacgacaacgggtt
ggcagtagagcacaagactcgactcccacggagactcccagagggaagccccagctcaac
ctgccgtcccaggcaccgctcctccgatgggtccttacactcagctttttggtggcaacg
gtggctgtgggactttatgtcatgtga

DBGET integrated database retrieval system