KEGG   Vulpes vulpes (red fox): 112929727
Entry
112929727         CDS       T05911                                 

Gene name
NPPA
Definition
(RefSeq) natriuretic peptides A
  KO
K12334  natriuretic peptide A
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04022  cGMP-PKG signaling pathway
vvp04024  cAMP signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04270  Vascular smooth muscle contraction
vvp04714  Thermogenesis
vvp04921  Oxytocin signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04924  Renin secretion
vvp04925  Aldosterone synthesis and secretion
vvp05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112929727 (NPPA)
   04024 cAMP signaling pathway
    112929727 (NPPA)
   04022 cGMP-PKG signaling pathway
    112929727 (NPPA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    112929727 (NPPA)
   04921 Oxytocin signaling pathway
    112929727 (NPPA)
   04924 Renin secretion
    112929727 (NPPA)
   04925 Aldosterone synthesis and secretion
    112929727 (NPPA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112929727 (NPPA)
  09159 Environmental adaptation
   04714 Thermogenesis
    112929727 (NPPA)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    112929727 (NPPA)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 112929727
NCBI-ProteinID: XP_025867685
UniProt: A0A3Q7UK23
LinkDB
Position
Unknown
AA seq 149 aa
MGSPIAASFLLFLAVQLLGQTGANPVYGSVSNAELLDFKNLLDRLEDKMPLEDEAESPQV
LSEQNAEAGAALSPLPEVPPWTGEVSPAQRDGGALGRSPWDSSDRSALLKSKLRALLAAP
RSLRRSSCFGGRMDRIGAQSGLGCNSFRY
NT seq 450 nt   +upstreamnt  +downstreamnt
atgggctcccccatcgccgcaagcttcctcctcttcctggcagttcagctcctggggcag
acgggcgctaaccccgtgtacggctctgtgtccaacgcagagctgctggatttcaagaac
ttgctggaccgcttggaggacaagatgcctttagaagatgaagccgagtctccccaagtc
ctgagtgagcagaatgcggaagctggggcagctctcagccccctgcctgaggtgcctccc
tggacgggggaggtcagcccagcccagagagatgggggtgcccttgggcgcagcccctgg
gactcctccgatagatctgccctcctgaagagcaagctgagagccctgcttgctgcccct
cggagcctgcggaggtccagctgcttcggaggcaggatggataggattggagcccagagc
ggactgggctgcaacagcttccggtactga

DBGET integrated database retrieval system