Vulpes vulpes (red fox): 112929727 Help Entry 112929727         CDS       T05911                                  Gene name NPPA Definition (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism vvp  Vulpes vulpes (red fox) Pathway vvp04022   cGMP-PKG signaling pathway vvp04024   cAMP signaling pathway vvp04066   HIF-1 signaling pathway vvp04270   Vascular smooth muscle contraction vvp04714   Thermogenesis vvp04921   Oxytocin signaling pathway vvp04923   Regulation of lipolysis in adipocytes vvp04924   Renin secretion vvp04925   Aldosterone synthesis and secretion vvp05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     112929727 (NPPA)    04024 cAMP signaling pathway     112929727 (NPPA)    04022 cGMP-PKG signaling pathway     112929727 (NPPA)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     112929727 (NPPA)    04921 Oxytocin signaling pathway     112929727 (NPPA)    04924 Renin secretion     112929727 (NPPA)    04925 Aldosterone synthesis and secretion     112929727 (NPPA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     112929727 (NPPA)   09159 Environmental adaptation    04714 Thermogenesis     112929727 (NPPA)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     112929727 (NPPA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  112929727 NCBI-ProteinID:  XP_025867685 UniProt:  A0A3Q7UK23 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MGSPIAASFLLFLAVQLLGQTGANPVYGSVSNAELLDFKNLLDRLEDKMPLEDEAESPQV LSEQNAEAGAALSPLPEVPPWTGEVSPAQRDGGALGRSPWDSSDRSALLKSKLRALLAAP RSLRRSSCFGGRMDRIGAQSGLGCNSFRY NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgggctcccccatcgccgcaagcttcctcctcttcctggcagttcagctcctggggcag acgggcgctaaccccgtgtacggctctgtgtccaacgcagagctgctggatttcaagaac ttgctggaccgcttggaggacaagatgcctttagaagatgaagccgagtctccccaagtc ctgagtgagcagaatgcggaagctggggcagctctcagccccctgcctgaggtgcctccc tggacgggggaggtcagcccagcccagagagatgggggtgcccttgggcgcagcccctgg gactcctccgatagatctgccctcctgaagagcaagctgagagccctgcttgctgcccct cggagcctgcggaggtccagctgcttcggaggcaggatggataggattggagcccagagc ggactgggctgcaacagcttccggtactga

DBGET integrated database retrieval system