KEGG   Vulpes vulpes (red fox): 112929738
Entry
112929738         CDS       T05911                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04012  ErbB signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04136  Autophagy - other
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04218  Cellular senescence
vvp04371  Apelin signaling pathway
vvp04613  Neutrophil extracellular trap formation
vvp04630  JAK-STAT signaling pathway
vvp04659  Th17 cell differentiation
vvp04714  Thermogenesis
vvp04910  Insulin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04920  Adipocytokine signaling pathway
vvp04930  Type II diabetes mellitus
vvp04931  Insulin resistance
vvp04935  Growth hormone synthesis, secretion and action
vvp05010  Alzheimer disease
vvp05014  Amyotrophic lateral sclerosis
vvp05016  Huntington disease
vvp05017  Spinocerebellar ataxia
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05221  Acute myeloid leukemia
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112929738 (MTOR)
   04371 Apelin signaling pathway
    112929738 (MTOR)
   04630 JAK-STAT signaling pathway
    112929738 (MTOR)
   04066 HIF-1 signaling pathway
    112929738 (MTOR)
   04072 Phospholipase D signaling pathway
    112929738 (MTOR)
   04151 PI3K-Akt signaling pathway
    112929738 (MTOR)
   04152 AMPK signaling pathway
    112929738 (MTOR)
   04150 mTOR signaling pathway
    112929738 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112929738 (MTOR)
   04136 Autophagy - other
    112929738 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    112929738 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    112929738 (MTOR)
   04659 Th17 cell differentiation
    112929738 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112929738 (MTOR)
   04920 Adipocytokine signaling pathway
    112929738 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    112929738 (MTOR)
   04919 Thyroid hormone signaling pathway
    112929738 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    112929738 (MTOR)
   04213 Longevity regulating pathway - multiple species
    112929738 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    112929738 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112929738 (MTOR)
   05206 MicroRNAs in cancer
    112929738 (MTOR)
   05205 Proteoglycans in cancer
    112929738 (MTOR)
   05230 Central carbon metabolism in cancer
    112929738 (MTOR)
   05231 Choline metabolism in cancer
    112929738 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112929738 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112929738 (MTOR)
   05212 Pancreatic cancer
    112929738 (MTOR)
   05225 Hepatocellular carcinoma
    112929738 (MTOR)
   05226 Gastric cancer
    112929738 (MTOR)
   05214 Glioma
    112929738 (MTOR)
   05221 Acute myeloid leukemia
    112929738 (MTOR)
   05215 Prostate cancer
    112929738 (MTOR)
   05224 Breast cancer
    112929738 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112929738 (MTOR)
   05014 Amyotrophic lateral sclerosis
    112929738 (MTOR)
   05016 Huntington disease
    112929738 (MTOR)
   05017 Spinocerebellar ataxia
    112929738 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    112929738 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112929738 (MTOR)
   04931 Insulin resistance
    112929738 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112929738 (MTOR)
   05168 Herpes simplex virus 1 infection
    112929738 (MTOR)
   05163 Human cytomegalovirus infection
    112929738 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112929738 (MTOR)
   05165 Human papillomavirus infection
    112929738 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112929738 (MTOR)
   01522 Endocrine resistance
    112929738 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112929738 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112929738 (MTOR)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112929738 (MTOR)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   112929738 (MTOR)
Membrane trafficking [BR:vvp04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    112929738 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 112929738
NCBI-ProteinID: XP_025867696
UniProt: A0A3Q7TR17
LinkDB
Position
Unknown
AA seq 2550 aa
MLGTGPAAATAATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPPQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTALPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSTRKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITSTTTAATTAATATATATSTEGSNSESEAESTENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRIT
CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILD
GVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETL
DVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7653 nt   +upstreamnt  +downstreamnt
atgcttggaaccggacctgctgccgccaccgcagccaccaccacgtcgagtaacgtgagc
gtcctacagcagttcgccagcggcctgaagagccggaatgaggagaccagggccaaggct
gccaaggagctccaacactatgtcaccatggagctccgagagatgagtcaagaggagtct
actcgcttctatgaccagctgaaccatcacatttttgaactggtctccagctcagatgcc
aatgagaggaaaggcggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccactcggattggcagattcgctaactatcttcggaacctcctcccctctaatgaccca
gttgtaatggagatggcatccaaggccattggccgccttgccatggcaggggacactttt
acggctgagtatgtggagtttgaggtgaagcgagccttggagtggctgggcgccgaccgc
aacgagggccggagacacgcagctgttctggttctccgtgagctggctgtcagcgtcccc
accttcttcttccagcaagtgcagccattctttgacaacatttttgtggctgtatgggac
cccaaacaggccatccgtgagggagctgtggctgcccttcgtgcctgtttgatcctcacc
acccagcgtgagccgaaggagatgcagaagcctcagtggtatcggcacacgtttgaagaa
gcagagaaagggtttgatgagacattggccaaggagaagggcatgaatcgggatgatcgc
atccatggagccttgctgatcctcaatgagttggtccgaatcagcagcatggagggagag
cgcctgagagaagaaatggaggagatcacgcagcagcagctggtgcacgacaagtactgc
aaggacctcatgggcttcgggacgaaacctcgccacatcacgcccttcaccagtttccag
gctgtccagcccccgcagtccaacgccttggtgggactgctggggtacagctctcaccaa
ggcctcatggggttcggggcttcccccagcccagccaagtctaccctggtggagagtcgg
tgttgccgagacctgatggaggagaaattcgatcaggtatgccagtgggtgctgaagtgc
aggaacagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcctggcc
gcgttccgaccttctgccttcacagatacccagtacctccaagataccatgaaccatgtg
ttaagctgcgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctgctt
tccgtggctgtgagatctgagtttaaggtctatttacctcgtgtgctggacatcatccgt
gcagccctaccccctaaggactttgcccataagagacagaaggccatgcaggtggatgcc
acagtgttcacctgcatcagcatgctggcccgcgcaatggggccgggcatccaacaagat
atcaaggagctgctggagcccatgctggcagtgggactgagccctgccctcactgctgtg
ctctacgacctgagccgtcagattccgcagctgaagaaggacatccaggatgggctcctg
aagatgctgtccctggtcctgatgcacaaacccctccggcacccgggcatgcccaagggc
ctggcccaccagctagcttcccccggcctcacagccctccccgaggccagcgatgtgggc
agcattactcttgccctgcgaactcttggcagctttgagtttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcatttcctaaacagcgagcacaaggagatccgcatg
gaagctgcccgcacctgctcccgcctgctcacgccctccgtccacctcatcagtggccac
gctcatgtggtcagccagactgcagtgcaagtggtggcagatgtgctcagcaaactactt
gtggttgggataacagatcctgaccctgacatccgctactgtgtcttggcgtccctggat
gagcgctttgatgcacacctggcccaggcagagaatttgcaggccctgtttgtggccctg
aacgaccaggtctttgagatccgggagctggccatctgcaccgtgggccggctcagtagc
atgaacccggccttcgtcatgcctttcctgcgcaagatgctcatccagattctgacggag
ctggagcacagcggtattggaagaatcaaagagcagagtgcccgcatgctggggcacctg
gtctccaatgccccccggctcatccgcccctacatggagcccatcctgaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaacaatgtcttggct
acaattggagaattggctcaggttagtggcctagagatgaggaagtgggtggatgaactc
tttattatcatcatggacatgctccaggactcctctctgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctacgtggtggagccctaccggaag
taccccactttgcttgaggtcctgctgaattttctgaagactgagcagaaccagggtaca
cggagagaggctatccgtgtgttagggcttttgggggccctggatccctacaagcacaaa
gtgaacatcggcatgattgaccagtcccgcgacgcttctgctgtcagcctgtctgaatcc
aagtcaagtcaggattcctccgactacagcaccagtgagatgctggtcaacatgggcaac
ctgcccctggacgagttctaccccgccgtgtccatggtggcgctgatgcggatcttccga
gaccagtccctctcgcaccatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctgggcctcaagtgtgtgcagtttctgccgcaggtcatgcccacattcctcaatgtc
attcgggtctgcgatggggccatccgggaattcctgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttacatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctccatccagagcacaatcattcttctcattgagcaaattgtg
gtagctcttgggggtgaatttaagctatacctgccccagctgatcccacacatgctccgc
gtcttcatgcatgacaacagcccaggccgcatcgtctccatcaagctgttggctgccatc
cagctgtttggtgccaacctggatgactatctgcatttgttgttgcctcctatcgtgaag
ctgtttgacgccccggaagttcctctgccatctcggaaggcagcgttagagactgtagac
cgcctgacagagtccctggacttcactgactatgcctcccgtatcattcatccgattgtt
cggacgctagaccagagcccggagctgcgtcccacagccatggacacattgtcttcactg
gtcttccaactggggaagaagtaccaaattttcattccaatggtgaataaagtcctggtg
cgacaccgaatcaaccatcagcgctacgacgttctcatctgcagaatcgtcaagggatac
acccttgctgatgaggaagaggaccctttgatttatcagcatcgaatgctgaggagtggc
caaggggatgcgttggctagtgggccagtagaaacgggacccatgaagaaactgcacgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaagacgactgg
ctggaatggctgaggcggctgagtctggagctcctgaaggactcctcgtcgccttccctg
cgctcgtgctgggccctggctcaggcctacaacccgatggccagggatctctttaatgct
gcatttgtgtcctgctggtctgaactgaatgaagaccagcaggatgaactcatcagaagc
atcgagttggccctcacctcacaggacatcgccgaagtcacgcagaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccattgagagacgacaatggcatt
gtcctactgggtgagagggcagccaagtgccgagcatatgccaaagcgctgcactacaaa
gaactggagttccagaaaggtcccacccccgccatcctagagtctctcatcagcattaat
aataagctacagcagccagaggcagcggccggggtgttagaatacgccatgaaacacttc
ggagagctggagatccaggctacctggtacgagaaactgcacgagtgggaggatgcgctg
gtggcctatgataagaagatggacacgaacaaggatgaccccgagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatgggggcagctccaccagcagtgctgtgaaaag
tggaccctggttaatgacgagacccaagccaagatggcccgcatggctgctgcagctgcg
tggggcttaggccagtgggacagcatggaggagtacacctgtatgatccctcgggacacc
cacgatggggcattttatagagctgtgctggcgctgcatcaggacctcttctccttggca
caacagtgcatcgacaaagccagagacctgctggatgcggagttaactgctatggcagga
gagagctacagtcgggcatatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgcatcgtggaagactggcagaaaatcctcatggtgcgg
tcgctggtggtcagccctcacgaggacatgaggacctggctcaagtatgccagcctgtgt
gggaagagtggcaggctggcccttgctcataaaaccttagtgttgctcctgggagtcgac
ccatctcggcagcttgaccatcctctgccaacagtgcaccctcaggtgacctacgcctac
atgaaaaacatgtggaagagtactcgcaagatcgatgccttccagcacatgcagcacttc
gtgcagaccatgcagcagcaagcgcagcatgccatcgcgaccgaggaccagcagcacaag
caagagctgcacaaactcatggcccggtgtttcctgaaacttggggagtggcagctgaac
cttcagggcatcaacgagagcacaatccccaaggtgctgcagtactacagcgctgccacg
gagcatgaccgcagctggtacaaggcctggcacgcgtgggcggtgatgaactttgaagct
gtgctgcactacaaacaccagaaccaagcccgggacgagaagaagaagttgcgtcacgcc
agcggggccaacatcaccagcacgaccaccgccgccaccacagcggccacggccacggcc
acggccaccagcaccgagggcagcaacagtgagagtgaggccgagagcaccgagaacagc
cccaccccgtctcctctgcagaagaaggtcactgaggatttgtccaagaccctcttgatg
tacacggtccccgccgtccagggcttcttccgttccatctccttgtcacgaggcaacaac
ctccaggacacactgagagtcctcaccttatggtttgactatggtcactggccagatgta
aacgaagccttggtggagggggtgaaagcgatccagattgacacctggttacaggttata
cctcagctcattgcgagaatcgatacgccccggcccttggtgggccgcctcattcaccag
cttctcacagacattggccggtaccacccccaggccctcatctaccccctgaccgtggca
tctaaatccaccacgacggcccgccacaacgcagccaacaagattctgaagaacatgtgc
gagcacagcaacaccctggtccagcaggccatgatggtgagtgaggagctcatccgcgtg
gccatcctctggcacgagatgtggcacgaaggcctggaagaagcgtcacgtttgtacttt
ggggagaggaacgtgaaaggcatgtttgaggtgctggagcccctgcatgctatgatggaa
cggggcccccagactctgaaggaaacatcttttaatcaggcatatggtcgagacttaatg
gaggcccaggagtggtgcaggaagtacatgaaatcagggaacgtcaaggacctcacccag
gcctgggacctctattaccacgtgttcagacggatctccaagcagctgcctcagctcacc
tccctggaactgcagtatgtttcccccaaacttctgatgtgccgggaccttgagttggcc
gtgccaggaacgtacgaccccaaccagcccatcattcgcattcagtccatagcaccgtcc
ctgcaggtcatcacctccaagcagaggccccggaagctgacgctcatgggcagcaacggg
catgagtttgttttcctcctgaagggccacgaagacctgcggcaggacgagcgggtgatg
cagctcttcggcctggtgaacacccttctggccaatgacccaacgtctcttcgcaagaac
ctcagcatccagagatacgctgtcatccccttatcaaccaactcgggcctcattggctgg
gtcccccactgcgacacgctgcacgccctcatccgggattacagagagaaaaagaagatc
cttctcaacatcgagcatcgcatcatgttgcggatggctccagactacgatcacctgacg
ctgatgcagaaggtggaggtgtttgagcacgccgtcaacaacacagccggggacgacctg
gccaagctgctgtggctgaaaagccctagctccgaggtatggtttgaccgaagaaccaac
tacacccgctctttagcggtcatgtccatggttgggtatattttgggcctgggagataga
cacccatccaatctgatgctggaccggctgagtgggaagatcctgcacatcgactttggg
gactgctttgaggttgctatgaccagagagaaattcccagagaagattccatttagacta
acaagaatgctgaccaatgctatggaggttacgggtctggacggcaactacagaatcacg
tgccacacggtgatggaggtgcttcgggaacacaaggacagcgtcatggccgtgctggaa
gcctttgtctacgaccccttgctgaactggaggctgatggacacaaataccaaaggcaac
aagcggtcccgaacaaggacagattcctactctgctggccagtcagtagaaattttggat
ggtgtggaacttggggaacccgcccacaagaaaacggggaccacagtgccggaatctatc
cattctttcattggagacggtttggtgaagccagaggccctaaataagaaagctatccag
atcattaacagggttcgagataagctcactgggcgggacttttctcacgacgaaaccctg
gatgtcccaacacaagtcgagctgctcatcaaacaggcaacatcccacgagaacctgtgt
cagtgctacatcggctggtgtcctttctggtaa

DBGET integrated database retrieval system