KEGG   Vulpes vulpes (red fox): 112929772
Entry
112929772         CDS       T05911                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp04115  p53 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04215  Apoptosis - multiple species
vvp04370  VEGF signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp05010  Alzheimer disease
vvp05012  Parkinson disease
vvp05014  Amyotrophic lateral sclerosis
vvp05016  Huntington disease
vvp05020  Prion disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05134  Legionellosis
vvp05145  Toxoplasmosis
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05215  Prostate cancer
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    112929772 (CASP9)
   04151 PI3K-Akt signaling pathway
    112929772 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112929772 (CASP9)
   04215 Apoptosis - multiple species
    112929772 (CASP9)
   04115 p53 signaling pathway
    112929772 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112929772 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112929772 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112929772 (CASP9)
   05212 Pancreatic cancer
    112929772 (CASP9)
   05215 Prostate cancer
    112929772 (CASP9)
   05213 Endometrial cancer
    112929772 (CASP9)
   05222 Small cell lung cancer
    112929772 (CASP9)
   05223 Non-small cell lung cancer
    112929772 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112929772 (CASP9)
   05012 Parkinson disease
    112929772 (CASP9)
   05014 Amyotrophic lateral sclerosis
    112929772 (CASP9)
   05016 Huntington disease
    112929772 (CASP9)
   05020 Prion disease
    112929772 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    112929772 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112929772 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    112929772 (CASP9)
   05152 Tuberculosis
    112929772 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112929772 (CASP9)
   05161 Hepatitis B
    112929772 (CASP9)
   05160 Hepatitis C
    112929772 (CASP9)
   05164 Influenza A
    112929772 (CASP9)
   05162 Measles
    112929772 (CASP9)
   05168 Herpes simplex virus 1 infection
    112929772 (CASP9)
   05163 Human cytomegalovirus infection
    112929772 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112929772 (CASP9)
   05169 Epstein-Barr virus infection
    112929772 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112929772 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112929772 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112929772 (CASP9)
   01002 Peptidases and inhibitors [BR:vvp01002]
    112929772 (CASP9)
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     112929772 (CASP9)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112929772 (CASP9)
Peptidases and inhibitors [BR:vvp01002]
 Cysteine peptidases
  Family C14: caspase family
   112929772 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 112929772
NCBI-ProteinID: XP_025867743
UniProt: A0A3Q7TD53
LinkDB
Position
Unknown
AA seq 495 aa
MDEADRRVLRRCRVRLVRELQVAALWDALLSRELFTAAMVEDLQAWRGGSRRHLPPAGAG
LCLWLSGRPRPGPRGLLADPTSLCFITQELGLNLHAGSGSRSDQARQLVIDLETRGSQAL
PLFITCLEDTGQDALASCLRMSRQAVKQNPEATRPLDLMPVVLGPTRLTPEDLRGKDPSK
LTPGKLAPVVLGPAELQPQVVRPLVPKPTDNGSRRFSDVCVQEISKGNGDLAYALNADPC
GYCLIINNVNFCPESRLAARGGSNIDCEKLQRRFGLLRFTVEVKWDLTAKQMVQALVELA
RRDHSALDCCVVVVLSHGCEASHRQFPGAVYGTDGCPVSIEKIVNIFNGTGCPSLGGKPK
LFFIQACGGEQKDHGFAVASASPEDRSPGSDSEPDAVPFQEGPGPFDQLDAVSSLPTPSD
IFVSYSTFPGFVSWRNTKSGSWYVETLDGVFEQWAHAEDLQTLLLRVANAVSQKGVYKQI
PGCFNFLRKKLYFKM
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggacgaggcggaccggcgggtgctgcggcggtgccgggtgcggctggtgcgggagctg
caggtggccgcgctctgggacgccctgctgagccgcgagctcttcacggccgccatggtc
gaggacctgcaggcctggagaggagggtccaggaggcacttgccaccagcaggtgcgggg
ctgtgtctgtggctttctggacgccccaggccagggccccggggcctgcttgcagaccca
acgtccctttgcttcatcacccaggagcttggcctgaacctgcatgcaggctcggggtct
cggagcgaccaggccaggcagctggtcatagatctagagacccgagggagtcaggccctt
cctttgttcattacctgcttggaggacacaggccaggatgcgctggcttcgtgcctgaga
atgagtcggcaagcagtaaagcagaatccagaggccaccagacccctggacctcatgcct
gtggtgcttggaccaacgagactcacaccagaggatctcagagggaaggatccatcaaag
ctgactccaggaaaacttgctccggtggtgctggggccagctgagctccagccacaggtt
gtcagaccattggtgcccaagccaacggacaatggttctagacgattcagtgatgtctgt
gttcaggagatttccaagggaaatggtgatttggcgtacgccctgaacgcagacccctgc
ggctactgcctcatcatcaacaacgtgaacttctgccccgagtcaaggctcgcggcccgc
ggtggctccaatatcgactgcgagaagctacagcgacgcttcggtctgctgcggttcacg
gtggaggtgaagtgggacctgacggccaagcaaatggtccaggctttggtggagctggcg
cggcgggaccacagtgctctggactgctgcgtggtggtcgtcctgtcccacggctgtgag
gccagccaccgccagttcccaggggccgtttatggcacagatggatgtcctgtgtccatt
gagaaaattgtgaacatcttcaatggaactggctgccccagcttgggagggaagcccaag
ctcttctttatccaggcctgtggtggggagcagaaagaccatgggtttgcagtggcctct
gcttcccctgaagacaggagccctggcagtgactctgagccagacgctgtcccgttccag
gaaggcccaggcccctttgaccagctggacgccgtgtctagtttgcccactcccagtgat
atctttgtatcctactccaccttcccaggctttgtttcctggagaaataccaagagcggc
tcctggtacgtggagaccttggatggtgtttttgagcagtgggctcacgctgaagacctg
cagaccctcctgctcagggtcgctaatgctgtttcgcagaaaggagtttacaaacagatt
cccggttgtttcaatttcctccggaaaaaactctattttaaaatgtaa

DBGET integrated database retrieval system