KEGG   Vulpes vulpes (red fox): 112929871
Entry
112929871         CDS       T05911                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor isoform X1
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04360  Axon guidance
vvp04510  Focal adhesion
vvp04520  Adherens junction
vvp05100  Bacterial invasion of epithelial cells
vvp05144  Malaria
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05211  Renal cell carcinoma
vvp05218  Melanoma
vvp05223  Non-small cell lung cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112929871 (MET)
   04014 Ras signaling pathway
    112929871 (MET)
   04015 Rap1 signaling pathway
    112929871 (MET)
   04020 Calcium signaling pathway
    112929871 (MET)
   04151 PI3K-Akt signaling pathway
    112929871 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112929871 (MET)
   04520 Adherens junction
    112929871 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    112929871 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112929871 (MET)
   05202 Transcriptional misregulation in cancer
    112929871 (MET)
   05206 MicroRNAs in cancer
    112929871 (MET)
   05205 Proteoglycans in cancer
    112929871 (MET)
   05230 Central carbon metabolism in cancer
    112929871 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112929871 (MET)
   05226 Gastric cancer
    112929871 (MET)
   05218 Melanoma
    112929871 (MET)
   05211 Renal cell carcinoma
    112929871 (MET)
   05223 Non-small cell lung cancer
    112929871 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    112929871 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    112929871 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112929871 (MET)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112929871 (MET)
Protein kinases [BR:vvp01001]
 Receptor tyrosine kinases (RTK)
  MET family
   112929871 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Pkinase_fungal Kinase-like Linker_histone
Other DBs
NCBI-GeneID: 112929871
NCBI-ProteinID: XP_025867934
UniProt: A0A3Q7SVW1
LinkDB
Position
Unknown
AA seq 1274 aa
MLLTMKAPAVLAPGILVLLFTLVQKSYGECKEALVKSEMNVNMKYQLPNFTAETPIQNVV
LHKHHIYLGAVNYIYVLNDKDLQKVAEYKTGPVLEHPDCSPCQDCSHKANLSGGVWEDNI
NMALLVDTYYDDQLISCGSVHRGTCQRHILPPSNIADIQSEVHCMYSSQADEEPSQCPDC
VVSALGTKVLISEKDRFINFFVGNTINSSDHPDHSLHSISVRRLKETQDGFKFLTDQSYI
DVLPEFRDSYPIKYVHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMP
LECILTEKRRKRSTREEVFNILQAAYVSKPGAHLAKQIGANLNDDILYGVFAQSKPDSAE
PMNRSAVCAFPIKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARNDE
YRTEFTTALQRVDLFMGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGLSTP
HVNFRLDSHPVSPAAIVEHPLNQNGYTLVVTGKKITRIPLNGLGCEHFQSCSQCLSAPPF
VQCGWCHDRCVHLEECPTGAWTQEVCLPAIYEVFPTSAPLEGGTVLTVCGWDFGFRRNNK
FDLKKTKVFLGNESCTLTLSESTTNMLKCTVGPAVNEHFNISIIISNGRGTAQYSTFSYV
DPIITSISPSYGPKNGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQA
TATEFPIKLKIDLANREMNSFSYQEDPIVYAIHPTKSFISGGSTITAVGKNLNSVSVLRM
VIDVHETRRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGIHSKYFDLIY
VHNPVFKPFEKPVMISIGNENVLKIKGNDIDPEAVKGEVLKVGNKSCETIYSDSKAVLCK
VPYDLLKLNNELNIEWKQAVSSTVLGKVIVQPDQNFTGLIAGAISISTIVLLLLGLFLWL
KRKKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNS
SQNGSCRQVQYPLTDLSPMLTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSS
LIVHFNEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFS
HPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYL
ASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESL
QTQKFTTKSDVVTY
NT seq 3825 nt   +upstreamnt  +downstreamnt
atgcttctcaccatgaaggctcctgctgtgcttgcacctggcatccttgtgcttctgttt
accttggtgcagaagagctatggggagtgcaaagaggcactagtaaagtctgagatgaat
gtgaacatgaagtatcagcttcccaacttcactgccgaaacacccatccagaatgttgtt
ctacacaagcatcatatttaccttggtgcagttaactatatttacgttttaaatgacaaa
gaccttcagaaggttgctgagtacaagactgggcccgtgctggaacacccagattgttcc
ccatgtcaggactgcagccacaaagccaatttatcaggtggtgtttgggaagataacatc
aacatggctctgcttgttgacacatactacgatgaccaactcattagctgtggcagtgtc
cacagagggacctgccagcgacacatccttccacccagcaatattgctgacatacagtcg
gaagtgcattgcatgtactcctcacaggcagatgaagagcccagccagtgccctgactgt
gtggtgagtgctctaggaaccaaagtcctgatatcagaaaaggaccggttcatcaacttc
tttgtgggcaataccataaattcctcggaccatccagatcattcattgcattcgatatcg
gtgagaaggctaaaggaaacgcaagatgggttcaagtttttgacagaccagtcttacatt
gatgttctaccggagttcagagactcctaccccattaaatatgtccacgcctttgaaagc
aaccactttatttactttttgacagtccagcgagaaactctagatgctcagacttttcac
acgagaataatcaggttctgttctgtagactctggattgcattcctacatggaaatgcct
ctggagtgtattctcacggaaaagagaagaaagagatccacgagggaggaagtgtttaat
attctccaagctgcatatgtcagtaagcctggggcccatctcgctaaacaaataggtgcc
aacctgaatgatgacattctctatggagtgtttgcacaaagcaagccagattctgctgaa
ccaatgaatcgctctgccgtctgtgcgttccctatcaaatatgtcaatgaattcttcaac
aagatcgtcaacaaaaacaatgtgagatgtcttcagcacttttatggacccaaccacgaa
cactgctttaataggacacttttgagaaattcatcgggctgtgaagcgcgcaatgatgaa
tatcgaacggagttcactacagctttgcagcgcgttgacttattcatgggccagttcaac
caagtcctcttaacgtctatatccaccttcatcaaaggagacctcaccattgctaatctt
gggacgtccgagggtcgcttcatgcaggtcgtggtttctcgatcgggattgtcgacccct
cacgtgaacttccgcctggactcccaccccgtgtctccagcagcgattgtggagcaccca
ctaaaccaaaacggctacacactggttgtcactgggaagaagatcaccaggatcccactg
aatggcttaggctgtgagcattttcagtcctgcagtcagtgtctctccgcccctcccttt
gtgcagtgtggctggtgccacgatagatgtgtgcacctggaggaatgtcccactggagcg
tggactcaggaggtctgtctgcctgcaatctatgaggttttcccaactagtgcacccctg
gaaggagggacagtgctgactgtatgtggctgggacttcggattcaggaggaataataaa
tttgatttaaagaaaaccaaagttttccttggaaatgagagctgcaccttgaccttaagt
gagagcacaacaaatatgctgaaatgcacagttggccctgcagtgaacgagcatttcaat
atatccataattatttcaaatggtcgagggacagcacaatatagtacattttcgtatgtg
gatcctattataacaagtatttctccaagttatggtcccaagaatggtggcaccttgctc
actttaactggaaaatacctcaacagtgggaattctagacacatttcaattggtggaaaa
acatgtactttaaaaagtgtgtcagatagtattctcgaatgttataccccagctcaagcc
actgcaactgagtttcctattaaattgaaaattgacctagccaaccgagagatgaacagc
ttcagttaccaggaagaccccattgtctatgcaattcatccaacgaaatcttttattagt
ggtgggagcacaataacagctgttggaaaaaacctgaattcagtgagtgtcctaaggatg
gtaatagatgtccatgaaacaagaaggaactttacagtggcatgtcaacatcgctctaat
tcagagataatctgttgtacgactccttcactgcaacagctgaatctgcaactccctctg
aaaaccaaagcctttttcatgttagatgggatccattccaaatactttgatctcatttat
gtacataatcctgtgtttaagccttttgaaaagccagtgatgatctcaataggcaatgaa
aatgtactgaaaattaagggcaatgatattgaccctgaagcagttaaaggcgaagtgtta
aaagttggaaataagagctgtgagactatctactcagattctaaagccgttttatgcaag
gtcccctatgacctgctgaaattgaacaacgagctaaatatagagtggaagcaagcagtt
tcttcaaccgtccttggaaaagtaatagttcaaccagatcagaatttcacaggactgatt
gctggtgctatctcaatatcaacaatagtcttattattactcggacttttcctgtggctg
aaaaggaaaaagcaaattaaagatctgggcagtgaattagttcgctatgatgcaagagta
cacactcctcatttggataggcttgtaagtgcccgaagtgtaagcccaactacagaaatg
gtttcaaatgaatctgtagactaccgagctacttttccagaagaccagtttcctaattca
tctcagaatggatcatgcagacaagtacaatatcctctgacggacctgtcccccatgctt
actagtggggactctgatatatccagtccattattgcaaaatactgtccacattgacctc
agtgctctaaatccagagctggtgcaggcagtccagcatgtagtgattgggccgagtagc
ctgattgtgcatttcaatgaagtcataggaagaggacattttgggtgtgtataccatggg
actttgttggacaatgacgacaaaaaaattcactgtgctgtgaaatccctgaatagaata
accgacataggagaagtttcccagtttctgaccgagggaatcatcatgaaagattttagt
catccaaacgtactctcactcttgggaatctgccttcgaagtgaggggtctccactggtg
gtcctaccatacatgaaacatggagatcttcgaaatttcattagaaatgagactcataac
ccaactgtaaaagatcttattggctttggtcttcaagtagccaaaggcatgaaatatctt
gcaagcaaaaagtttgtccacagagacttggctgcaagaaactgtatgctggatgaaaaa
ttcactgtcaaggttgctgattttggtcttgccagagacatgtatgataaagaatactac
agcgtacacaacaaaacaggcgccaaactaccagtgaagtggatggctttagaaagtctg
caaactcagaagtttaccaccaagtcagatgtggtaacgtactga

DBGET integrated database retrieval system