KEGG   Vulpes vulpes (red fox): 112930309
Entry
112930309         CDS       T05911                                 

Gene name
SIVA1
Definition
(RefSeq) apoptosis regulatory protein Siva isoform X1
  KO
K22744  apoptosis regulatory protein Siva
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112930309 (SIVA1)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 112930309
NCBI-ProteinID: XP_025868471
UniProt: A0A3Q7TTI3
LinkDB
Position
Unknown
AA seq 203 aa
MPKRGCPFADAAPLQLKVRVGQRELGRGVCGEQHSREVFEKTKQLLFRGAQAYMDHLWEE
GCAIVDLPESPKPGPTEALRVARGQMLIGPDGRLTRSRAQASEADPSGAATRACSSCVRA
VDGKAACGQCERALCGRCVHVCSSCGGVACALCALVETLLCDLLNYCGPVNPNWMPGGSR
VGGHSCGDVHESVLCASCAMFEA
NT seq 612 nt   +upstreamnt  +downstreamnt
atgcccaagcggggctgtccgttcgcggacgcggcccccctgcagctgaaggtccgcgtg
ggtcagagggagctgggccgcggcgtgtgcggcgagcagcactcgcgggaggtcttcgag
aaaaccaagcaactcctttttcgaggggcccaggcctacatggaccacttgtgggaggaa
ggctgtgccattgttgacctgccggagtccccaaagcctggccccacagaggcccttcgg
gtagcccgtgggcagatgctgattggaccagatggccgactgaccaggagccgagcgcag
gcctctgaagctgacccctccggggcagcgaccagagcctgttcctcgtgtgtgcgagcc
gtggacgggaaggcagcgtgtggccagtgtgagcgtgccctctgtgggcggtgtgtgcac
gtctgctccagctgcgggggcgtggcctgtgccctgtgtgcccttgtggagaccctcctc
tgcgatttgctgaactactgtggtccagtaaatcctaactggatgccaggaggttcccgt
gtggggggccacagctgtggtgacgttcacgagtcggtgctctgtgccagctgcgccatg
ttcgaggcctga

DBGET integrated database retrieval system