KEGG   Vulpes vulpes (red fox): 112930669
Entry
112930669         CDS       T05911                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp04115  p53 signaling pathway
vvp04210  Apoptosis
vvp04215  Apoptosis - multiple species
vvp05010  Alzheimer disease
vvp05012  Parkinson disease
vvp05014  Amyotrophic lateral sclerosis
vvp05016  Huntington disease
vvp05020  Prion disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05134  Legionellosis
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05164  Influenza A
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112930669 (APAF1)
   04215 Apoptosis - multiple species
    112930669 (APAF1)
   04115 p53 signaling pathway
    112930669 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112930669 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112930669 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112930669 (APAF1)
   05012 Parkinson disease
    112930669 (APAF1)
   05014 Amyotrophic lateral sclerosis
    112930669 (APAF1)
   05016 Huntington disease
    112930669 (APAF1)
   05020 Prion disease
    112930669 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    112930669 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    112930669 (APAF1)
   05152 Tuberculosis
    112930669 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112930669 (APAF1)
   05160 Hepatitis C
    112930669 (APAF1)
   05164 Influenza A
    112930669 (APAF1)
   05162 Measles
    112930669 (APAF1)
   05168 Herpes simplex virus 1 infection
    112930669 (APAF1)
   05169 Epstein-Barr virus infection
    112930669 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112930669 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 AAA_16 Utp8 Hira AAA_22
Other DBs
NCBI-GeneID: 112930669
NCBI-ProteinID: XP_025868810
UniProt: A0A3Q7UNG6
LinkDB
Position
Unknown
AA seq 1250 aa
MDAKARNCLLQYREALEKDIKTSYIMDRMINDGVLTISEEEKVKNEPTQQQRAALLIKTI
LKKDNYSYISFYNALIHEGYKDLAALLHSGIPVISSSNGGKDSVGGITSHVKTVLCEGGV
PQRPVVFVTRKKLVNAIRQNLFKLSGEPGWVVIYGMAGCGKSVLAAEAVRDHFFLDGCFP
GGVHWVSVGKQDKAGLLMKLQNLCTRLDQDENFSQRPPLNIEEAKDRLRLLMLRKHPRSL
LILDDIWDSWILKAFDNQCQILLTTRDKSVTDSVMGPKYIVAVESDLGKEKGLEILSLFV
NMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWDYYLRQLQNKQFKRIRKSSFY
DYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFV
NKSLLFCDRNGKSFRYYLHDLQVDFLIEKNRNQLQDLHKKIVTQFQKHYQPHTLSPDQED
CMYWYNFLAYHMASASMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCA
VCENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDHGMLYLEWIN
KKNIKNLSRLVVRPHTDAVYHACFSEDGQRIASCGVDKTLQVFKAETGEKLLEIKAHEDE
VLCCAFSTDDRFIATCSVDKKVKIWNSMTGGLVHVYDEHSEQVNCCHFTNNSHYLLLATA
SSDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDVKSANERK
SINVKQFFLNSEEPQEDMEVIVKCCSWSADGTRIMVAAKNKIFLFDIHTGGLLAEIHTGH
HSTIQYCDFSPQNHLAVVALSQCCVELWNMDSCLKVADCRGHLSWVHCVMFSPDGSSFLT
SSDDQTIRLWETKKVCKNSAIVLKQEIDVVFQENEVMVLAVDNIKRLQLINGKTGQIDYL
IEAQVSCCCLSPHLQYIAFGGEDGAVEILELLNNRIFQSRIGHKKTVRHIQFTDDGKTLI
SSSDDSSIQVWNWQSEEYVFLQAHQETVKDFKLLKNSKLLSWSFDGTVKIWSIITGRIEK
DFVCHQDTVLSCDISPDATKFSSTSADKTAKIWSFELLSPLHELRGHKGCVRCSVFSVDS
TLLATGDDNGEIRIWNVSNGELLHLCAPILVEEGAATHGGWVTDLCFSPDSKMLVSAGGY
LKWWNVVTGESSQTFYTNGTCLKKIHVSSDFKTYVTVDNLGILYILQMLE
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaactgtttgcttcaatatagagaagccttggaaaaggacatc
aaaacgtcctacatcatggatcgtatgattaatgacggagttttaacaatatcagaggag
gaaaaagtaaaaaatgagcccactcaacagcaacgagcagctctgctaattaaaacaata
cttaaaaaagataattattcctacatatcattctacaatgctctgatacacgaagggtat
aaagatcttgctgcccttctccatagtggcattcctgtcatctcttcttccaacggtggc
aaagattcagttggtggaataacttcacatgtgaagacagtcctgtgtgagggtggagtg
ccacagaggccggttgtttttgttaccaggaagaagctggtgaatgcaattcgtcagaac
ctattcaaactaagtggtgaaccaggatgggttgtcatatatggaatggcaggttgcggg
aagtctgttttagctgcagaagctgttcgagatcattttttcttagatggctgtttccca
gggggtgtacactgggtttcagttgggaaacaagacaaagctgggcttctgatgaaattg
cagaatctttgcacacggttggatcaggatgagaatttctctcagaggcctccactcaat
attgaagaagctaaagaccgtcttcgccttcttatgctgcgcaaacacccaaggtctctg
ttgatcttggatgatatttgggattcctggatattaaaagcttttgacaatcagtgtcag
attcttcttacaaccagagacaagagcgttacagattcagtaatgggtcctaaatatata
gtcgctgtggagagtgacttaggaaaagaaaaaggacttgaaattctgtccctctttgtt
aatatgaagaaagcagatttgccagagcaagctcatagtattataaaagaatgtaaaggt
tctcctcttgtagtgtctttaattggtgcacttctacgtgattttcctaaccgttgggat
tactacctcaggcaacttcagaataagcaatttaagagaataaggaaatcttcattttat
gattatgaggctctggatgaagccatgtctataagtgttgaaatgctcagagaggacatc
aaagattactacacagatctttccatccttcagaaggatgttaaggtgcctacaaaggtg
ttatgtattctctgggacatggaaactgaagaagttgaagatattctgcaggagtttgtt
aataagtctctcttattctgtgatcggaatggaaaatcatttcgttattatttacatgat
cttcaagtagatttccttatagagaagaatcgcaatcaacttcaggatctgcataagaag
atagtcactcagttccagaaacattaccagccacatactctttcaccagatcaggaggac
tgcatgtactggtacaattttctggcctaccacatggctagtgccagtatgcacaaagaa
ctttgtgctttaatgttttccttggattggattaaagcaaaaactgaactcgtaggccct
gctcatctgattcatgaatttgtggaatacaggcatatattggatgaaaaggattgtgca
gtctgtgaaaatttccaggagtttttatctttaaatggacatcttcttggacgacagcca
tttcctaatattgtacaactgggtctgtgtgaaccagaaacttcagaagtttatcagcaa
gctaagctgcaggccaagcaggaggtcgatcatggaatgctttacctggagtggataaac
aaaaaaaacatcaagaatctttcccgcttagttgtccgcccccatacagatgctgtttac
catgcttgcttttctgaggatggtcaaagaatagcttcttgtggagttgataaaacctta
caggtgttcaaagctgaaacaggagagaaactgctagaaatcaaggctcatgaagatgaa
gtgctttgttgtgcattctctacagatgacagatttatagcaacctgctcagtggataaa
aaagtgaagatttggaattctatgacagggggactagtacatgtctatgatgaacactca
gagcaagtcaactgctgccactttaccaacaacagtcattaccttctcttagccactgca
tcaagtgactgcttcctcaaactctgggatttgaatcaaaaagaatgtcgaaataccatg
tttggccatacaaattcagtcaatcactgcagattttcaccagatgataagcttttggct
agttgttcagctgatggaacattaaagctttgggatgtaaaatcagcaaatgagaggaaa
agcattaatgtgaagcagttcttcctaaattcagaggagcctcaagaggatatggaagtg
atagtgaaatgttgttcatggtctgctgatggcactaggataatggtggcagcaaaaaat
aaaatctttctatttgacattcatactggtggcttattggcagaaatccatacaggccat
cacagcaccatccagtactgtgacttctccccccaaaatcatttggcagtagtggctttg
tcccagtgctgtgtggagttgtggaatatggactcatgtttaaaagtggctgattgcaga
ggacatttaagttgggttcattgtgtgatgttttctcccgatggatcatcatttttgaca
tcttctgatgaccagacaatcaggctctgggagaccaaaaaagtatgtaagaactctgct
atagtgttaaagcaagaaatagatgttgtgtttcaagaaaatgaagtgatggttcttgca
gttgacaatataaaacgtctgcagctcattaatggaaaaacaggtcagattgattatctg
attgaagctcaggttagttgctgttgcctaagtccacatcttcagtacattgcatttgga
ggtgaagatggagccgttgagattttagaactcctaaacaacagaatcttccaatccagg
attgggcacaagaaaactgtgcggcacatccagttcacagatgatgggaagactcttatt
tcaagctctgatgattcttcaattcaggtatggaattggcagtcagaggaatatgtcttc
ctacaagcccatcaggaaactgtgaaagactttaagctcctgaaaaattcaaaactgctt
tcctggtcatttgatggaacagtaaagatatggagtattattactggaagaatagaaaaa
gactttgtctgtcaccaggatacagtactttcttgtgatatttctcctgatgctaccaag
ttttcatctacatctgcagataagactgcgaagatttggagttttgaacttctttcacct
cttcatgaattgaggggccacaagggctgtgtgcgctgctctgtcttctctgtggacagt
accctgttggcgactggagatgacaatggagaaatcaggatatggaatgtctcaaatggt
gagctgcttcatttgtgtgctccgattttggtagaagaaggagctgctacccatggaggc
tgggtgactgacctttgcttttctccggatagcaaaatgcttgtctctgctggaggatat
cttaagtggtggaatgttgtcactggggaatcctcacagaccttctacacaaatggaacc
tgtcttaagaaaatacacgtgtcctctgacttcaaaacatatgtgactgttgataatctt
gggattttatatattttacagatgttagagtaa

DBGET integrated database retrieval system