KEGG   Vulpes vulpes (red fox): 112930717
Entry
112930717         CDS       T05911                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04114  Oocyte meiosis
vvp04115  p53 signaling pathway
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04510  Focal adhesion
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04730  Long-term depression
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04913  Ovarian steroidogenesis
vvp04914  Progesterone-mediated oocyte maturation
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05205  Proteoglycans in cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05224  Breast cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112930717 (IGF1)
   04014 Ras signaling pathway
    112930717 (IGF1)
   04015 Rap1 signaling pathway
    112930717 (IGF1)
   04066 HIF-1 signaling pathway
    112930717 (IGF1)
   04068 FoxO signaling pathway
    112930717 (IGF1)
   04151 PI3K-Akt signaling pathway
    112930717 (IGF1)
   04152 AMPK signaling pathway
    112930717 (IGF1)
   04150 mTOR signaling pathway
    112930717 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112930717 (IGF1)
   04115 p53 signaling pathway
    112930717 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112930717 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112930717 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    112930717 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    112930717 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    112930717 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112930717 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    112930717 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112930717 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    112930717 (IGF1)
   04213 Longevity regulating pathway - multiple species
    112930717 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112930717 (IGF1)
   05202 Transcriptional misregulation in cancer
    112930717 (IGF1)
   05205 Proteoglycans in cancer
    112930717 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    112930717 (IGF1)
   05218 Melanoma
    112930717 (IGF1)
   05215 Prostate cancer
    112930717 (IGF1)
   05224 Breast cancer
    112930717 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112930717 (IGF1)
   05414 Dilated cardiomyopathy
    112930717 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112930717 (IGF1)
   01522 Endocrine resistance
    112930717 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:vvp04052]
    112930717 (IGF1)
Cytokines and growth factors [BR:vvp04052]
 Growth factors
  Growth factors (RTK binding)
   112930717 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 112930717
NCBI-ProteinID: XP_025868877
UniProt: A0A3Q7U6C3
LinkDB
Position
Unknown
AA seq 187 aa
MGKISSLPTQLFKCCFCDFLKVKMHTVSSSHLFYLALCLLTFPSPATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKYHPPSTTKRMKSQRRRKGGPKKRPGGEQKVGTEASQQMKGKKKEQR
RETGARN
NT seq 564 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccgtgtcctcctcgcacctcttctacctggcactgtgcttgctc
accttccccagccccgccacagccgggcctgagacgctctgcggggctgagctggtggat
gctcttcagttcgtgtgcggagacagggggttctacttcaacaagcccacaggttacggc
tccagcagtcggagggcacctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctgaggaggctagagatgtactgtgcacccctcaagcctgccaagtctgcccgctca
gtccgtgcccagcgccacaccgacatgcccaaggctcagaagtatcatcccccatctacc
accaagagaatgaagtctcagaggagaaggaaaggtgggccaaagaaacgcccaggaggg
gaacagaaggtggggactgaagcaagtcagcagatgaaaggaaagaagaaagagcagaga
agggagactggagctagaaactga

DBGET integrated database retrieval system