KEGG   Vulpes vulpes (red fox): 112930794
Entry
112930794         CDS       T05911                                 

Gene name
TGFBR1
Definition
(RefSeq) TGF-beta receptor type-1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04060  Cytokine-cytokine receptor interaction
vvp04068  FoxO signaling pathway
vvp04144  Endocytosis
vvp04218  Cellular senescence
vvp04350  TGF-beta signaling pathway
vvp04371  Apelin signaling pathway
vvp04380  Osteoclast differentiation
vvp04390  Hippo signaling pathway
vvp04520  Adherens junction
vvp04659  Th17 cell differentiation
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05142  Chagas disease
vvp05161  Hepatitis B
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05220  Chronic myeloid leukemia
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112930794 (TGFBR1)
   04350 TGF-beta signaling pathway
    112930794 (TGFBR1)
   04390 Hippo signaling pathway
    112930794 (TGFBR1)
   04371 Apelin signaling pathway
    112930794 (TGFBR1)
   04068 FoxO signaling pathway
    112930794 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112930794 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112930794 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    112930794 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    112930794 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112930794 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112930794 (TGFBR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112930794 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112930794 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112930794 (TGFBR1)
   05212 Pancreatic cancer
    112930794 (TGFBR1)
   05225 Hepatocellular carcinoma
    112930794 (TGFBR1)
   05226 Gastric cancer
    112930794 (TGFBR1)
   05220 Chronic myeloid leukemia
    112930794 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112930794 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112930794 (TGFBR1)
   05161 Hepatitis B
    112930794 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112930794 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112930794 (TGFBR1)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     112930794 (TGFBR1)
Protein kinases [BR:vvp01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   112930794 (TGFBR1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 112930794
NCBI-ProteinID: XP_025868986
UniProt: A0A3Q7TUV3
LinkDB
Position
Unknown
AA seq 510 aa
MWQELSGGGSLRPDAQDQGASRGPEALQPQAPLQVVTQCALQCFCHLCTKDNFTCVTDGL
CFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPT
VGKPSSGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISE
GTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKI
FSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLN
RYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLG
LAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIAR
RCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRE
CWYANGAARLTALRIKKTLSQLSQQEGIKM
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtggcaggaattgtcaggaggcggctccctccgcccggatgcacaggaccaaggggcg
agccggggcccggaggccctgcagccccaggccccgcttcaggtggtgactcagtgcgca
ttacagtgtttctgccacctttgtacaaaagacaattttacttgtgtgacagatgggctc
tgctttgtctctgtcacagagaccacagacaaagttatacacaatagcatgtgcatagct
gaaattgacctgattcctcgagacagaccatttgtatgtgcaccatcttcaaaaactggg
tctgttactacaacctattgctgcaaccaggaccactgcaataaaatagaactcccaact
gttggaaagccatcatctggccttggtcccgttgaactggcagctgtcattgctggacca
gtctgcttcgtctgcatctcacttatgttgatggtttatatttgccataaccgtaccgtc
attcaccatcgagtgccaaatgaagaggatccttccttagatcgcccttttatttcagag
ggcactacattaaaagatttaatttatgatatgacaacatcaggttctggatcaggttta
ccattgcttgttcagagaacaattgcaagaactattgtattacaagaaagtattggcaaa
ggtcgatttggagaagtttggcgaggaaagtggagaggagaagaagttgctgttaaaatc
ttctcctctagagaagagcgctcatggttccgtgaggcagagatttatcagaccgtaatg
ttacgtcatgaaaacatcttgggatttatagcagcagacaataaagacaatggtacatgg
actcagctctggttggtgtcagattatcatgagcatggatccctctttgattatttgaac
agatacacagttactgtggaaggaatgataaaacttgctttgtccacagcaagtggactt
gcacatctccacatggagattgttggtacccaagggaaaccagccattgctcatagagat
ttgaaatctaagaatatcttggtaaagaagaatggaacttgctgtattgcagacttagga
ctggcagtgagacatgattcagccacagataccattgatattgctccaaatcacagagtg
ggaacaaaaaggtacatggcccccgaagttctagatgattccataaatatgaaacacttt
gaatccttcaaacgtgccgacatctatgcaatgggcttagtattctgggaaatagctcga
cgatgttccattggtggaattcatgaagattaccagctgccttattatgatcttgtacct
tctgatccatcagttgaagaaatgagaaaagttgtttgtgaacagaagttaaggccaaat
attccaaacagatggcagagttgtgaagccttgagagtaatggctaaaattatgagagaa
tgttggtatgccaatggagcagcgaggcttacagctttgcggattaagaaaacattgtca
caactcagtcaacaggaaggcatcaaaatgtag

DBGET integrated database retrieval system