KEGG   Vulpes vulpes (red fox): 112931366
Entry
112931366         CDS       T05911                                 

Gene name
BBC3
Definition
(RefSeq) LOW QUALITY PROTEIN: bcl-2-binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp04115  p53 signaling pathway
vvp04210  Apoptosis
vvp04215  Apoptosis - multiple species
vvp04390  Hippo signaling pathway
vvp05016  Huntington disease
vvp05162  Measles
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112931366 (BBC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112931366 (BBC3)
   04215 Apoptosis - multiple species
    112931366 (BBC3)
   04115 p53 signaling pathway
    112931366 (BBC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112931366 (BBC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112931366 (BBC3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112931366 (BBC3)
  09172 Infectious disease: viral
   05162 Measles
    112931366 (BBC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112931366 (BBC3)
SSDB
Motif
Pfam: PUMA Hepatitis_core
Other DBs
NCBI-GeneID: 112931366
NCBI-ProteinID: XP_025869806
UniProt: A0A3Q7TX21
LinkDB
Position
Unknown
AA seq 202 aa
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLC
APTAPRSHRRPGGXPAVTAALGAPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSA
PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQRHRPSPWRVL
YNLIMGLLPLPRGRGAPEMEPN
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcccgagcacgccaagagggcagctccccggagcccgtagagggcctggcccgcgac
ggtccgcgcccgtttcccctcagccgcctggtgccctcggccgtgtcctgcggcctctgc
gagcccggcctgcccgccgcccccgctgcccctgccctgctgcccgctgcctacctctgc
gcccccaccgccccgcgcagtcaccgccgccctgggggcnngcccgccgtcaccgccgcc
ctgggggccccccgctggcctgggggtccccgcagccggccccgaggcccgcgccccgac
ggtcctcagccctcactgtcgccggcggaacagcacctggaatcgccggtgcccagcgcc
ccgggggccctggcgggcggtcccacccaagcagccccgggagtccggggggaggaggag
cagtgggcccgggagatcggggcccagctgcggcggatggcggacgacctcaacgcgctg
tacgagcggcggagacaagaggagcagcagcgacaccgcccctcaccctggagggtcctg
tacaatctcatcatgggactcctgcccttacccaggggccgtggagccccggagatggag
cccaattag

DBGET integrated database retrieval system