KEGG   Vulpes vulpes (red fox): 112931372
Entry
112931372         CDS       T05911                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04071  Sphingolipid signaling pathway
vvp04115  p53 signaling pathway
vvp04141  Protein processing in endoplasmic reticulum
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04215  Apoptosis - multiple species
vvp04217  Necroptosis
vvp04722  Neurotrophin signaling pathway
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05012  Parkinson disease
vvp05014  Amyotrophic lateral sclerosis
vvp05016  Huntington disease
vvp05020  Prion disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05132  Salmonella infection
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05203  Viral carcinogenesis
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05216  Thyroid cancer
vvp05217  Basal cell carcinoma
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112931372 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    112931372 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112931372 (BAX)
   04215 Apoptosis - multiple species
    112931372 (BAX)
   04217 Necroptosis
    112931372 (BAX)
   04115 p53 signaling pathway
    112931372 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112931372 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    112931372 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112931372 (BAX)
   05202 Transcriptional misregulation in cancer
    112931372 (BAX)
   05203 Viral carcinogenesis
    112931372 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112931372 (BAX)
   05212 Pancreatic cancer
    112931372 (BAX)
   05225 Hepatocellular carcinoma
    112931372 (BAX)
   05226 Gastric cancer
    112931372 (BAX)
   05214 Glioma
    112931372 (BAX)
   05216 Thyroid cancer
    112931372 (BAX)
   05220 Chronic myeloid leukemia
    112931372 (BAX)
   05217 Basal cell carcinoma
    112931372 (BAX)
   05218 Melanoma
    112931372 (BAX)
   05213 Endometrial cancer
    112931372 (BAX)
   05224 Breast cancer
    112931372 (BAX)
   05222 Small cell lung cancer
    112931372 (BAX)
   05223 Non-small cell lung cancer
    112931372 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112931372 (BAX)
   05014 Amyotrophic lateral sclerosis
    112931372 (BAX)
   05016 Huntington disease
    112931372 (BAX)
   05020 Prion disease
    112931372 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    112931372 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112931372 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112931372 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112931372 (BAX)
   05152 Tuberculosis
    112931372 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112931372 (BAX)
   05170 Human immunodeficiency virus 1 infection
    112931372 (BAX)
   05161 Hepatitis B
    112931372 (BAX)
   05160 Hepatitis C
    112931372 (BAX)
   05164 Influenza A
    112931372 (BAX)
   05162 Measles
    112931372 (BAX)
   05168 Herpes simplex virus 1 infection
    112931372 (BAX)
   05163 Human cytomegalovirus infection
    112931372 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112931372 (BAX)
   05169 Epstein-Barr virus infection
    112931372 (BAX)
   05165 Human papillomavirus infection
    112931372 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112931372 (BAX)
   01524 Platinum drug resistance
    112931372 (BAX)
   01522 Endocrine resistance
    112931372 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vvp03029]
    112931372 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vvp02000]
    112931372 (BAX)
Mitochondrial biogenesis [BR:vvp03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    112931372 (BAX)
Transporters [BR:vvp02000]
 Other transporters
  Pores ion channels [TC:1]
   112931372 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 112931372
NCBI-ProteinID: XP_025869812
UniProt: A0A3Q7U997
LinkDB
Position
Unknown
AA seq 205 aa
MSHPSSLGPLGPKSPGTSSLLSPLGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPL
EQVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNW
GRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGT
PTWQTVTIFVAGVLTASLTIWKKMG
NT seq 618 nt   +upstreamnt  +downstreamnt
atgagccaccctagttcgctgggtcccctaggacccaagagtccaggcacctcttccctc
ctttctcctctagggcccaccagctctgagcagatcatgaagacaggggcccttttgctt
cagggtttcatccaagatcgagcagggcgaatggggggagagacacctgagctgcccttg
gagcaggtgccccaggatgcatccaccaagaagctgagcgagtgtctcaagcgcatcgga
gatgaactggacagtaacatggagttgcagaggatgattgcagctgtggacacagactct
ccccgtgaggtcttcttccgagtggcagctgagatgttttctgatggcaacttcaactgg
ggccgggttgttgccctcttctactttgccagcaaactggtgctcaaggccctgtgtacc
aaggtgcccgagctgatcaggaccatcatgggctggacactggacttccttcgagagcgg
ctgctgggctggatccaggaccagggtggttgggacggcctcctctcctactttgggaca
cccacgtggcagacagtgaccatctttgtggctggagtgcttactgcgtcactcaccatc
tggaaaaagatgggctga

DBGET integrated database retrieval system