KEGG   Vulpes vulpes (red fox): 112931753
Entry
112931753         CDS       T05911                                 

Gene name
SIAH1
Definition
(RefSeq) E3 ubiquitin-protein ligase SIAH1 isoform X1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp04120  Ubiquitin mediated proteolysis
vvp04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112931753 (SIAH1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112931753 (SIAH1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112931753 (SIAH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:vvp04121]
    112931753 (SIAH1)
Enzymes [BR:vvp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112931753 (SIAH1)
Ubiquitin system [BR:vvp04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    112931753 (SIAH1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 112931753
NCBI-ProteinID: XP_025870266
UniProt: A0A3Q7TY97
LinkDB
Position
Unknown
AA seq 313 aa
MTGKSPLPFLYSWRGVLLTCLPAAGTRKRKEMSRQTATALPTGTSKCTPSQRVPALTGTT
ASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEK
VANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLM
HQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIV
QLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAE
NGNLGINVTISMC
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaccgggaagtctcccttaccttttctgtactcctggaggggcgtcttgctcacatgt
ctgccagcagctgggacaaggaagagaaaagaaatgagccgccagactgcaacagcatta
cctactggaacctcaaagtgtaccccgtctcagagggtgcccgccctgactggcacaacc
gcatccaacaatgacttggcgagtctttttgagtgtccggtctgctttgactatgtgtta
ccacccattcttcagtgtcagagtggccatcttgtttgtagcaactgtcgcccaaagctc
acatgttgtccaacctgccggggccctttgggatccattcgcaacttggctatggagaaa
gtggccaattccgtacttttcccttgtaaatatgcctcttctggatgtgaaataactttg
ccacacacagaaaaagcagaccacgaagagctctgtgagtttaggccttattcatgtccg
tgccctggtgcttcctgtaaatggcaaggctctttggatgctgtcatgccccatctgatg
catcagcataagtccattacgaccctacagggagaggatatagttttccttgcaacagac
attaaccttcctggtgctgttgactgggtgatgatgcagtcctgttttggctttcacttc
atgttagtattggagaaacaggaaaagtatgatggtcaccagcagttctttgcaattgta
cagctgataggaacacgcaagcaagctgaaaattttgcttatcgacttgagctaaatggt
cataggcggcgattgacttgggaagcgactccgcgctctattcatgagggaattgccacg
gccattatgaatagtgactgcctagtctttgacaccagcattgcacagctttttgcagaa
aatggcaatttaggcatcaatgtaactatttccatgtgttga

DBGET integrated database retrieval system