KEGG   Vulpes vulpes (red fox): 112931790
Entry
112931790         CDS       T05911                                 

Gene name
SFN
Definition
(RefSeq) 14-3-3 protein sigma
  KO
K06644  stratifin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112931790 (SFN)
   04115 p53 signaling pathway
    112931790 (SFN)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112931790 (SFN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112931790 (SFN)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112931790 (SFN)
  Exosomal proteins of colorectal cancer cells
   112931790 (SFN)
  Exosomal proteins of bladder cancer cells
   112931790 (SFN)
SSDB
Motif
Pfam: 14-3-3 SIKE
Other DBs
NCBI-GeneID: 112931790
NCBI-ProteinID: XP_025870317
UniProt: A0A3Q7UAU4
LinkDB
Position
Unknown
AA seq 248 aa
MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKGNEESSEEKGPEVREYREKVETELRGVCDAVLGLLDSHLIKEAGDAESRVFY
LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG
EAPEEPQS
NT seq 747 nt   +upstreamnt  +downstreamnt
atggagagagccagtctgatccagaaggccaagttggcagaacaggctgagcgctacgag
gacatggcagccttcatgaagagcgccgtggaaaagggtgaggagctgtcctgcgaagag
cgaaacctgctctcggtggcctacaagaacgtggtggggggccagagggctgcctggagg
gtcctgtccagtatcgagcagaaaggcaatgaggagagctcggaagagaagggcccggag
gtgcgagagtaccgggagaaggtggagaccgagctccggggcgtgtgtgacgcggtgctg
ggcctgctggacagccacctcatcaaggaggccggggatgccgaaagtcgagtcttctac
ctgaagatgaagggcgactactaccgctacctggccgaggtggccactggtgacgacaag
aagcgcatcattgactcagcccggtccgcctaccaggaggccatggacatcagcaagaag
gagatgccacccaccaaccccatccgcctgggcctggccctgaacttttctgtcttccac
tacgagatcgccaacagccccgaggaggccatctcactggccaagaccaccttcgacgag
gccatggctgacctgcacaccctcagcgaggactcctacaaagacagcaccctcatcatg
cagctgctgagagacaacctgacgctgtggaccgccgacaacgccggggaagaggggggc
gaggctcccgaggaaccccagagctga

DBGET integrated database retrieval system