KEGG   Vulpes vulpes (red fox): 112931965
Entry
112931965         CDS       T05911                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp04010  MAPK signaling pathway
vvp04060  Cytokine-cytokine receptor interaction
vvp04115  p53 signaling pathway
vvp04210  Apoptosis
vvp04217  Necroptosis
vvp04650  Natural killer cell mediated cytotoxicity
vvp04668  TNF signaling pathway
vvp04932  Non-alcoholic fatty liver disease
vvp04940  Type I diabetes mellitus
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05142  Chagas disease
vvp05143  African trypanosomiasis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05320  Autoimmune thyroid disease
vvp05330  Allograft rejection
vvp05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112931965 (FAS)
   04668 TNF signaling pathway
    112931965 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112931965 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112931965 (FAS)
   04217 Necroptosis
    112931965 (FAS)
   04115 p53 signaling pathway
    112931965 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112931965 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112931965 (FAS)
   05205 Proteoglycans in cancer
    112931965 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112931965 (FAS)
   05330 Allograft rejection
    112931965 (FAS)
   05332 Graft-versus-host disease
    112931965 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112931965 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    112931965 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112931965 (FAS)
   04932 Non-alcoholic fatty liver disease
    112931965 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112931965 (FAS)
   05161 Hepatitis B
    112931965 (FAS)
   05160 Hepatitis C
    112931965 (FAS)
   05164 Influenza A
    112931965 (FAS)
   05162 Measles
    112931965 (FAS)
   05168 Herpes simplex virus 1 infection
    112931965 (FAS)
   05163 Human cytomegalovirus infection
    112931965 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112931965 (FAS)
   05169 Epstein-Barr virus infection
    112931965 (FAS)
   05165 Human papillomavirus infection
    112931965 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112931965 (FAS)
   05143 African trypanosomiasis
    112931965 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112931965 (FAS)
Cytokine receptors [BR:vvp04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   112931965 (FAS)
CD molecules [BR:vvp04090]
 Proteins
  112931965 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 Stn1_C
Other DBs
NCBI-GeneID: 112931965
NCBI-ProteinID: XP_025870567
UniProt: A0A3Q7UBL2
LinkDB
Position
Unknown
AA seq 315 aa
MWGAWAVGCLTLASIAGLWPRGVKAQVTGLSYKVLRSGRNVTMGDVRCWEDPLHGNSLCC
DACPPGTRKESDCTSYAGKSHCVPCQEGEEYTDKTHLSPKCRRCGICDGEHGLEVERNCT
QTRNTKCRCKPNFYCDVSPCEHCNPCSTCEHGILERCTPTSDTKCEEGSSSGYLWFCVLI
PILTSALVCWWLFKRRRTKGNVTLGPTPSPPTEVLPINFADIDLSKYIIGIAEQMKIKQV
REFVRKNGINEAKIDEIKNDNLQDTAEQKVQLLRHWYQVHGRRGAYHTLIRGLRKAHLRA
LAERIQETIQKDVAS
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtggggggcctgggccgtcggctgtctgacgctcgcctccatcgctggactgtggccc
aggggggtgaaggctcaagtgaccggcctcagctacaaagtgttgagatcgggtaggaac
gtcaccatgggagacgtcaggtgctgggaagacccgcttcacgggaacagcctgtgctgt
gatgcgtgtcctcctggcacacggaaggaaagtgactgcacgtcttatgcgggtaaatca
cactgtgtgccctgccaagaaggggaggagtacacagacaagacgcatttgtctcctaaa
tgcaggagatgtggaatctgcgatggagagcatggcttagaagtggaaagaaactgtact
cagacccggaataccaagtgcagatgtaaaccaaacttctactgtgacgtctctccgtgc
gaacactgcaacccatgtagcacgtgtgaacatggaatccttgagaggtgcacaccgacc
agcgacaccaaatgtgaagaaggatccagctccggatacctgtggttttgcgtcctcatc
ccgattctgacgtctgcgctcgtgtgctggtggctgttcaaacggcgcaggacaaaaggg
aatgtcaccctgggacccacaccgtcccctcctactgaagtgctaccaataaactttgca
gacatcgacctgagcaaatacatcatcggcatcgctgaacaaatgaaaataaaacaggtc
agggaattcgttcggaagaacgggatcaacgaagccaagatagacgagatcaagaatgac
aacctgcaggacacagcggagcagaaggtgcaactgctgcgtcactggtaccaggtgcat
gggaggaggggcgcgtatcacaccttaatcagaggcctcagaaaagcccatcttcgcgcg
ctggcggagaggattcaggaaacgatccagaaggacgttgccagttag

DBGET integrated database retrieval system