KEGG   Vulpes vulpes (red fox): 112932168
Entry
112932168         CDS       T05911                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X1
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04024  cAMP signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04270  Vascular smooth muscle contraction
vvp04540  Gap junction
vvp04611  Platelet activation
vvp04713  Circadian entrainment
vvp04714  Thermogenesis
vvp04724  Glutamatergic synapse
vvp04726  Serotonergic synapse
vvp04728  Dopaminergic synapse
vvp04730  Long-term depression
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04911  Insulin secretion
vvp04912  GnRH signaling pathway
vvp04913  Ovarian steroidogenesis
vvp04915  Estrogen signaling pathway
vvp04916  Melanogenesis
vvp04918  Thyroid hormone synthesis
vvp04921  Oxytocin signaling pathway
vvp04922  Glucagon signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04924  Renin secretion
vvp04925  Aldosterone synthesis and secretion
vvp04926  Relaxin signaling pathway
vvp04927  Cortisol synthesis and secretion
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04934  Cushing syndrome
vvp04935  Growth hormone synthesis, secretion and action
vvp04961  Endocrine and other factor-regulated calcium reabsorption
vvp04962  Vasopressin-regulated water reabsorption
vvp04970  Salivary secretion
vvp04971  Gastric acid secretion
vvp04972  Pancreatic secretion
vvp04976  Bile secretion
vvp05012  Parkinson disease
vvp05030  Cocaine addiction
vvp05031  Amphetamine addiction
vvp05032  Morphine addiction
vvp05034  Alcoholism
vvp05142  Chagas disease
vvp05146  Amoebiasis
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112932168
   04020 Calcium signaling pathway
    112932168
   04072 Phospholipase D signaling pathway
    112932168
   04024 cAMP signaling pathway
    112932168
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112932168
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112932168
  09152 Endocrine system
   04911 Insulin secretion
    112932168
   04922 Glucagon signaling pathway
    112932168
   04923 Regulation of lipolysis in adipocytes
    112932168
   04912 GnRH signaling pathway
    112932168
   04913 Ovarian steroidogenesis
    112932168
   04915 Estrogen signaling pathway
    112932168
   04921 Oxytocin signaling pathway
    112932168
   04926 Relaxin signaling pathway
    112932168
   04935 Growth hormone synthesis, secretion and action
    112932168
   04918 Thyroid hormone synthesis
    112932168
   04928 Parathyroid hormone synthesis, secretion and action
    112932168
   04916 Melanogenesis
    112932168
   04924 Renin secretion
    112932168
   04925 Aldosterone synthesis and secretion
    112932168
   04927 Cortisol synthesis and secretion
    112932168
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112932168
   04270 Vascular smooth muscle contraction
    112932168
  09154 Digestive system
   04970 Salivary secretion
    112932168
   04971 Gastric acid secretion
    112932168
   04972 Pancreatic secretion
    112932168
   04976 Bile secretion
    112932168
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112932168
   04961 Endocrine and other factor-regulated calcium reabsorption
    112932168
  09156 Nervous system
   04724 Glutamatergic synapse
    112932168
   04728 Dopaminergic synapse
    112932168
   04726 Serotonergic synapse
    112932168
   04730 Long-term depression
    112932168
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112932168
  09159 Environmental adaptation
   04713 Circadian entrainment
    112932168
   04714 Thermogenesis
    112932168
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112932168
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112932168
  09165 Substance dependence
   05030 Cocaine addiction
    112932168
   05031 Amphetamine addiction
    112932168
   05032 Morphine addiction
    112932168
   05034 Alcoholism
    112932168
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    112932168
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112932168
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112932168
   05165 Human papillomavirus infection
    112932168
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112932168
   05142 Chagas disease
    112932168
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112932168
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112932168
  Exosomal proteins of other body fluids (saliva and urine)
   112932168
  Exosomal proteins of colorectal cancer cells
   112932168
  Exosomal proteins of bladder cancer cells
   112932168
GTP-binding proteins [BR:vvp04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    112932168
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA
Other DBs
NCBI-GeneID: 112932168
NCBI-ProteinID: XP_025870800
UniProt: A0A3Q7UU41
LinkDB
Position
Unknown
AA seq 973 aa
MGVRNCLDGNNMSGQRDIPLELGEQPEQPSLEAPGAAAPSPGPGAAEEMETQPPHSEPIP
VETEGEACGPPEVSRPNFQDLGETVKEAGAHGAYSPPPEEAMPFEVEQPSSGGFWPTPEQ
PGDTTGAHAGLEVSRPSLMESGAFDDARPGLGGYSPPPEEAMPFEFEQPAQGGCNQPPLQ
VSDLAPGGPGAGVYTTPPQEPRALKPANAGFRGDRSPPPEEAMPFEFDGAAFGDDSPPPG
LPRAIPQIDGGGGGGGESAAAAVPSAVLLAPAANEPPLWVPGAIGSPSREAVRPPPHFAG
DSPPMEISGPPLEIGSAPVGVDDAPVNMDSPPIALDGPPIEVSRAPVKRARAEGERPPVE
GEAAEMEGGSAAAAAEGGKVSSPGDGAPAARAKPASPAAGAAAAAPDAPAAGAAPAAPDA
PAAGAAAPAARAAPAAGAAAPASRAAPASRAAPAAPASGARPKLRFLRPPSPEIQAADPP
TPQPPRAFAWRGRSGRSRDDDEGSVSSDDDHSSDESDDGTSGCRRWLQPRRNRRRRKPRR
NLLRNFLMQAFGGCFGRAESPQPKAAHSPKVKKIPLAEKRRQMRKEALEKRAQKRAEKKR
SKLIDKQLQEEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARS
NSDGSEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFD
FPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCR
VLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDN
QTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTP
EDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRD
IIQRMHLRQYELL
NT seq 2922 nt   +upstreamnt  +downstreamnt
atgggcgtgcgcaactgcctcgacggcaataatatgtcaggacaacgcgatatccccctt
gaactcggggaacagcccgagcaaccatctttggaggccccaggggcagctgcccccagt
cctgggcctggcgcagccgaagagatggagacccaaccgcctcacagcgagcccatcccc
gtcgagactgaaggcgaggcctgtggacccccagaggtctccaggcccaacttccaagac
ctgggcgagaccgtcaaggaagccggagcccatggagcctacagcccaccacctgaggaa
gccatgccctttgaggtcgagcagcccagctcaggaggcttctggcctacccccgagcag
cctggagacaccactggggcccatgcaggccttgaggtctcccgcccatcgctcatggag
tccggagccttcgatgatgccagaccaggcctgggaggctacagccctccacctgaggaa
gccatgccctttgagtttgagcagcctgcacagggaggttgcaaccagcctcccctgcag
gtctcagacctggctccaggaggcccaggtgcaggggtctataccacccctccccaggag
ccccgggctctcaaacctgcaaacgcaggcttcagaggagaccggagccctccccctgag
gaggctatgccatttgagtttgatggagcagccttcggggacgacagcccaccccccggg
ctcccccgagctatcccacaaatcgacggcggcggcggcggcggcggcgagtccgcggca
gccgcggtcccgagtgcggtcctcctcgctcccgccgcgaacgagccccccctctgggtc
ccaggcgccatcggcagcccatcccgagaggctgtcagacctcctccacacttcgcgggc
gacagccccccgatggagatctccggacccccgctcgagattggcagcgcccccgttggg
gtcgacgacgctcccgtcaacatggacagccccccaatcgcgcttgacggcccgcccatc
gaggtctcccgagccccagttaagagagcgcgagcagagggagagagacccccagttgag
ggagaagcagccgagatggaaggaggctcggccgccgctgctgcggagggaggaaaagtc
tcctctccgggggacggagcccctgccgcccgggccaagcctgcttctccagccgccggg
gcagccgctgccgcccctgacgctccagccgccggggcagccccagccgcccctgacgct
ccagccgccggggcagccgctcctgccgcccgggcagctcctgccgccggggcagccgct
cctgcctcccgggccgcccctgcctcccgggccgcccctgccgcccctgcgtctggagcc
cgacccaagctccgcttccttagaccccccagccccgagatccaggctgccgatccgcct
actccacagcctcctcgcgcatttgcctggcggggcaggtctggccgcagccgcgacgac
gacgaggggtcggtcagcagcgacgacgaccacagcagcgatgagtccgacgatgggacc
tccggatgccgccgctggctgcagccccggcggaaccgccgccgccgaaagccccggcgc
aacttgctccgcaacttcctcatgcaggccttcgggggctgcttcggccgagctgagagc
ccccagcccaaagccgcgcacagccccaaggtcaagaagattcctctggcggagaagcgc
agacagatgcgcaaggaagccctggagaagcgcgcccagaagcgcgcagagaagaaacgc
agcaagctcatcgacaagcaactccaggaagaaaagatggggtacatgtgtacgcaccgc
ctgctgcttctaggtgccggagaatctggtaaaagcaccattgtgaagcagatgaggatc
ctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaagctgcaaggagc
aacagcgatggtagtgagaaggcaaccaaagttcaggacatcaaaaacaacctgaaagag
gcgatcgaaaccatcgtggccgccatgagcaacctggtgccccccgtggagctggccaac
cctgagaaccagttcagagtggactacattctgagcgtgatgaacgtgcctgactttgac
ttccctcctgagttctatgagcatgccaaggctctgtgggaggatgaaggagtgcgtgcc
tgctatgagcgctccaacgagtaccagctgattgactgcgcccagtacttcctggacaag
attgatgtcatcaagcaggctgactacgtgcccagtgatcaggatctgcttcgctgccgc
gtcctgacttctggaatctttgagaccaagttccaggtggacaaagtcaacttccacatg
tttgacgtgggtggccagcgcgatgagcgccgcaaatggatccaatgcttcaatgatgtg
actgccatcatcttcgtggtggccagcagcagctacaacatggtcattcgggaggacaac
cagaccaaccgcctgcaggaggctctgaacctcttcaagagcatctggaacaacagatgg
ctgcgcaccatctctgtgattctgttcctcaacaagcaagacctgctcgctgagaaagtc
cttgctggaaaatcgaagattgaggactactttccagaatttgctcgctacactactcct
gaggatgctactcccgagcccggagaggacccacgcgtgacccgggccaagtacttcatc
cgcgacgaatttctgagaatcagcactgctagtggagatgggcgccactactgctacccc
cacttcacttgcgctgtggacaccgagaacattcgccgtgtgttcaacgactgccgtgac
atcattcagcgcatgcaccttcgtcagtacgagctgctctaa

KEGG   Vulpes vulpes (red fox): 112932169
Entry
112932169         CDS       T05911                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04024  cAMP signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04270  Vascular smooth muscle contraction
vvp04540  Gap junction
vvp04611  Platelet activation
vvp04713  Circadian entrainment
vvp04714  Thermogenesis
vvp04724  Glutamatergic synapse
vvp04726  Serotonergic synapse
vvp04728  Dopaminergic synapse
vvp04730  Long-term depression
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04911  Insulin secretion
vvp04912  GnRH signaling pathway
vvp04913  Ovarian steroidogenesis
vvp04915  Estrogen signaling pathway
vvp04916  Melanogenesis
vvp04918  Thyroid hormone synthesis
vvp04921  Oxytocin signaling pathway
vvp04922  Glucagon signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04924  Renin secretion
vvp04925  Aldosterone synthesis and secretion
vvp04926  Relaxin signaling pathway
vvp04927  Cortisol synthesis and secretion
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04934  Cushing syndrome
vvp04935  Growth hormone synthesis, secretion and action
vvp04961  Endocrine and other factor-regulated calcium reabsorption
vvp04962  Vasopressin-regulated water reabsorption
vvp04970  Salivary secretion
vvp04971  Gastric acid secretion
vvp04972  Pancreatic secretion
vvp04976  Bile secretion
vvp05012  Parkinson disease
vvp05030  Cocaine addiction
vvp05031  Amphetamine addiction
vvp05032  Morphine addiction
vvp05034  Alcoholism
vvp05142  Chagas disease
vvp05146  Amoebiasis
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112932169
   04020 Calcium signaling pathway
    112932169
   04072 Phospholipase D signaling pathway
    112932169
   04024 cAMP signaling pathway
    112932169
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112932169
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112932169
  09152 Endocrine system
   04911 Insulin secretion
    112932169
   04922 Glucagon signaling pathway
    112932169
   04923 Regulation of lipolysis in adipocytes
    112932169
   04912 GnRH signaling pathway
    112932169
   04913 Ovarian steroidogenesis
    112932169
   04915 Estrogen signaling pathway
    112932169
   04921 Oxytocin signaling pathway
    112932169
   04926 Relaxin signaling pathway
    112932169
   04935 Growth hormone synthesis, secretion and action
    112932169
   04918 Thyroid hormone synthesis
    112932169
   04928 Parathyroid hormone synthesis, secretion and action
    112932169
   04916 Melanogenesis
    112932169
   04924 Renin secretion
    112932169
   04925 Aldosterone synthesis and secretion
    112932169
   04927 Cortisol synthesis and secretion
    112932169
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112932169
   04270 Vascular smooth muscle contraction
    112932169
  09154 Digestive system
   04970 Salivary secretion
    112932169
   04971 Gastric acid secretion
    112932169
   04972 Pancreatic secretion
    112932169
   04976 Bile secretion
    112932169
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112932169
   04961 Endocrine and other factor-regulated calcium reabsorption
    112932169
  09156 Nervous system
   04724 Glutamatergic synapse
    112932169
   04728 Dopaminergic synapse
    112932169
   04726 Serotonergic synapse
    112932169
   04730 Long-term depression
    112932169
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112932169
  09159 Environmental adaptation
   04713 Circadian entrainment
    112932169
   04714 Thermogenesis
    112932169
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112932169
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112932169
  09165 Substance dependence
   05030 Cocaine addiction
    112932169
   05031 Amphetamine addiction
    112932169
   05032 Morphine addiction
    112932169
   05034 Alcoholism
    112932169
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    112932169
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112932169
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112932169
   05165 Human papillomavirus infection
    112932169
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112932169
   05142 Chagas disease
    112932169
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112932169
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112932169
  Exosomal proteins of other body fluids (saliva and urine)
   112932169
  Exosomal proteins of colorectal cancer cells
   112932169
  Exosomal proteins of bladder cancer cells
   112932169
GTP-binding proteins [BR:vvp04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    112932169
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 112932169
NCBI-ProteinID: XP_025870808
UniProt: A0A3Q7TMB3
LinkDB
Position
Unknown
AA seq 247 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSGAQVFPEPPESDHEHEEADLELSLPECLEYEEEFDYESETETETESEIE
SETDFETEPETAPATEPETEPEDERGPVVPKHTSFGQSLTERLHALRLRSPDASPSRAQP
STQEPQNPREGEEPEPKPEDKDPRDPEESEEPKEKKQQRRCKPKKPTRRDPSPESPSKRG
PIPIRRH
NT seq 744 nt   +upstreamnt  +downstreamnt
atggatcgtaggtcccgggctcagcagtggcgccgagctcgccacaactacaacgatctg
tgcccacccatcggccgccgggcagccaccgcgctcctctggctctcctgctccatcgcg
ctcctccgcgccctcgccacctccaacgcccgcgcccagcagcgcgcggccgcccagcag
cgccggagcttccttaacgcccaccaccgctccggcgcccaggtgttccccgagcccccc
gagtcggaccacgagcacgaggaggccgacctcgagctgtccctccccgagtgcctagag
tacgaggaagagtttgactacgaatctgagaccgagaccgagaccgagtctgaaatcgaa
tccgagaccgacttcgagaccgagcctgagaccgcccccgccactgagcccgagaccgag
ccagaggacgagcgcggccccgtggtgcccaagcacaccagcttcggccaatctctcacc
gagcgtctgcacgctctgagattgcggagccccgacgcctccccgagtcgcgcgcagccc
agcactcaggagccccagaaccccagggagggggaggagcccgagcccaagcccgaggac
aaggatccgagggaccccgaagagtccgaggagccaaaggagaagaagcagcagcgccgc
tgcaagccgaagaagcccacccgccgcgacccgtccccggagtccccttccaaaagggga
cccatccccatccggcgtcactaa

DBGET integrated database retrieval system