KEGG   Vulpes vulpes (red fox): 112932383Help
Entry
112932383         CDS       T05911                                 

Definition
(RefSeq) odorant-binding protein-like
Organism
vvp  Vulpes vulpes (red fox)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 112932383
NCBI-ProteinID: XP_025871100
UniProt: A0A3Q7UUY1
LinkDB All DBs
Position
Unknown
AA seq 177 aa AA seqDB search
MKIQLLCLALVLASDAQLPLPNILTQVSGPWKTLYISSNNLDKIGENSPFRVYMRGINVD
IPRLKMLFNFYVKVDGECVEKSVEGSIGRDNLINADYDGGNYFRFTDITPNALIGYNVNV
DSKGRITKLASLVGRGAHVNEEDIAKFKKLSREKDIPEENIIYLGDTDNCPNHEKQQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacaactgttgtgtcttgcactcgttttggctagtgatgcccagctacccctt
cctaatatactgacacaggtttcaggaccatggaagaccttgtacatatcatccaacaac
cttgacaagattggtgagaatagcccgttcagggtttatatgagaggtatcaatgtggac
ataccaagactcaaaatgttattcaatttttatgtcaaggttgacggagagtgcgttgaa
aagtctgttgagggatcaataggacgagacaatcttatcaatgctgattatgatggtggc
aattatttccgatttactgatataaccccaaatgctctcataggctataatgtcaatgtg
gatagcaaagggagaatcacaaaactggcttcgttggttggcagaggagctcatgttaat
gaggaggacattgcaaagttcaagaagctgagtagagaaaaggatattccagaagaaaac
attatatacttaggcgatactgacaactgtcccaaccatgaaaaacaacagtga

DBGET integrated database retrieval system