KEGG   Vulpes vulpes (red fox): 112933146
Entry
112933146         CDS       T05911                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00220  Arginine biosynthesis
vvp00330  Arginine and proline metabolism
vvp01100  Metabolic pathways
vvp04020  Calcium signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04146  Peroxisome
vvp04371  Apelin signaling pathway
vvp04926  Relaxin signaling pathway
vvp05010  Alzheimer disease
vvp05014  Amyotrophic lateral sclerosis
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05133  Pertussis
vvp05140  Leishmaniasis
vvp05142  Chagas disease
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05152  Tuberculosis
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    112933146 (NOS2)
   00330 Arginine and proline metabolism
    112933146 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112933146 (NOS2)
   04066 HIF-1 signaling pathway
    112933146 (NOS2)
   04020 Calcium signaling pathway
    112933146 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112933146 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112933146 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112933146 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112933146 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112933146 (NOS2)
   05014 Amyotrophic lateral sclerosis
    112933146 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    112933146 (NOS2)
   05152 Tuberculosis
    112933146 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112933146 (NOS2)
   05145 Toxoplasmosis
    112933146 (NOS2)
   05140 Leishmaniasis
    112933146 (NOS2)
   05142 Chagas disease
    112933146 (NOS2)
Enzymes [BR:vvp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     112933146 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 112933146
NCBI-ProteinID: XP_025872031
UniProt: A0A3Q7U2K8
LinkDB
Position
Unknown
AA seq 1156 aa
MREGLGAACEAARPRLCRLLRRILRPQPACRPPRASLVTQDDPKCHSLSKHRDESPQSLT
GTVKTSPESTIKPAAPPLACPQHVRIKNWGNGMTFQDTLHHKAKGDLACKSKSCLGAIMN
PKSLTREPRDKPTPPDELLPQAIEFVNQYYSSFKEAKIEEHLARVEAVTKEIETTGTYQL
TGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAKEMFEHICRHLRYASNNGNIR
SAITVFPQRTDGKHDFRVWNAQLIRYAGYQMPDGTILGDPASVEFTQLCIDLGWKPKYGR
FDVVPLVLQADGQDPEFFEIPPDLVLEVPMEHPKYEWFRELELKWYALPAVANMLLEVGG
LEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVIEINVA
VLHSFQKQNVTIMDHHSAAESFMKYMQSEYRSRGGCPADWIWLVPPISGSITPVFHQEML
NYVLSPFYYYQVEAWKTHVWQDEKRRPQRRKIQLKVLVKAVLFASMLMRKTMASRVRVTI
LFATETGKSETLARDLGALFSCAFHPKVLCMDEYKLSHLEEEQLLLVVTSTFGNGDSPGN
GEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPIGEGDE
LSGQEEAFRCWAVQTFKAACETFDVRGKHCIQIPRLYTSNVTWDPHQYRLVQDSQPLDLN
KALSRMHAKNVFTLRLKSQRNLQSPKSSRTTLLVELSCEDSQELSYLPGEHLGVFPGNQL
ALVQGILERVVDSPAPHQPVHLETLSERGSYWVRDKRLPPCSLSQALTYFLDITTPPTQL
LLRKLAQLATEEAERQRLEILCQPSQYNKWKLTNSPTFLEVLEEFPSLRVSAGFLLSQLP
ILKPRYYSISSSRDCTPMEVHLTVAVLVYPTRDGQGPLHHGVCSTWLSNLKPQDPVPCFV
RSAGNFKLPEDPSRPCILIGPGTGIAPFRSFWQQRLHDIKHKGLRGSRMTLVFGCRRPDE
DHLYREEMLEMAQSGVLHEVHTAYSRLPGQPKVYVQDILRQQLASQVLRMLHEEQGHLYV
CGDVRMARDVAHTLKHLVAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDGA
AKQPSDPRVPAAHGRS
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgcgcgaggggctgggcgctgcgtgcgaggccgcccggccccggctctgccgcctcctc
cgcaggatcctgcggccgcagcccgcctgcaggcccccgcgagccagtctagtgacacag
gatgaccccaagtgtcacagcctcagcaagcaccgggatgagtccccccagtccctcaca
gggacggtaaagacgtctccagaatccacaatcaagccagctgcgcccccactggcctgc
ccacagcatgtgaggatcaaaaactggggcaacgggatgaccttccaagacacacttcac
cacaaggccaaaggggatcttgcttgcaagtccaagtcttgtctgggagccatcatgaac
cccaaaagtttgaccagagaacccagggacaagccaacccccccagacgagcttctacct
caagccattgaatttgtcaaccagtattacagctccttcaaagaggcaaaaatagaggaa
catctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctatcagctg
acgggggatgagctcatcttcgccaccaagcaggcctggcgcaacgctccccgctgcatc
gggaggatccagtggtccaacctccaggtctttgatgcccggagctgttccactgccaag
gaaatgtttgagcacatctgcagacacctgcgttatgccagcaacaatggcaacatcagg
tcggccatcaccgtgttcccccagcgaactgatgggaagcatgacttccgagtctggaac
gcccagctcatccgctatgctggctaccagatgcccgatggcactatcctgggggaccct
gccagtgtggagttcacccagctgtgcatcgacctgggctggaagcccaagtacggccgc
tttgatgtggtgcctctggtgctgcaggctgatggccaagaccctgagttctttgaaatc
ccacctgaccttgtgctcgaggtacccatggaacatcccaagtatgagtggttccgggag
ctggagctgaagtggtacgccctgcctgcagtggccaacatgctgcttgaggtgggtggc
ctcgagttcccagggtgccccttcaatggctggtacatgggcacggagattggggtccgg
gacttctgtgatgttcagcgctacaacatcctggaggaagtgggcagaaggatgggcctg
gaaacacacaagctggcctcactctggaaggaccgggctgtcattgagatcaatgtcgct
gtactccacagtttccagaagcaaaatgtgaccatcatggatcaccactcagctgcagag
tccttcatgaagtacatgcagagcgagtaccgctcccgagggggctgccctgccgactgg
atttggctggtccccccgatttctgggagtatcactcctgtgttccaccaggagatgtta
aattatgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtgtgg
caggatgagaagcggagaccccagaggagaaagattcaacttaaagtcttggttaaagct
gtgctttttgcctccatgctgatgcgcaagaccatggcatcccgagtcagagtcacaatc
ctctttgcaacagagacgggcaagtcagaaacgctagcccgggacctaggggccttgttc
agctgtgccttccaccccaaggttctctgcatggacgagtacaagctgagccacctggag
gaggagcagctactattggtggtgaccagcacgtttgggaacggagactcccctggcaat
ggagagaaactaaaaaaatctctcttcatgctgaaagagcttaccaacaagttcaggtat
gccgtgtttggcctcggctccagcatgtaccctcagttctgtgcctttgctcatgacatc
gaccagaagctatcgcatctgggggcctctcagcttgccccaataggggaaggggatgag
ctcagtggacaggaggaagccttccgctgctgggccgtgcaaaccttcaaggcagcctgt
gagacatttgatgtgcgaggcaaacactgcattcagatccccaggctctacacttccaat
gtgacctgggacccacaccaatacaggctcgtgcaggactcgcagcctctggacctcaac
aaagccctcagcagaatgcatgccaagaacgtgttcaccctgaggctcaaatcacaacgg
aatctacagagtccaaaatccagccgcaccactctcctggtcgagctctcctgtgaggac
agccaggagctgagctacctgccaggagaacatctcggagttttcccaggcaaccagctg
gccctggtgcaaggcatcttggagcgagtagtagacagccctgcaccccaccagcctgtg
cacctggagaccctcagcgagaggggaagctactgggtcagagacaagcggctgcctcca
tgctcactcagccaggccctcacctacttcctggacatcaccactcccccaacccagctg
ctgctccgaaagctggcacagctggccacagaagaggccgagaggcagaggttggagatc
ctgtgccagccctcacagtacaacaagtggaagttaaccaacagtcccaccttcctggaa
gtgctggaggagttcccatccctgcgggtgtctgctggcttcctgctctcccagctccct
attctgaaaccgcggtactactccatcagctcctccagggactgcacacccatggaggtc
cacctcacggtggctgtgctcgtgtaccccacccgagatggccaaggtcctttgcaccat
ggtgtctgtagcacatggctcagcaacctgaagccccaagacccagtaccctgctttgta
cgaagtgccggcaacttcaagctccccgaggatccctcccgtccttgcatcctcattgga
cctggcacaggcatcgcccccttccgcagtttctggcagcagcggctccatgacatcaag
cacaaagggctccggggcagccgcatgaccctggtgtttgggtgccgccgcccagatgag
gaccacctgtatcgggaggagatgttggagatggcccagagtggggtgctgcatgaggtg
cacacagcctattctcgcctgcctggccagcccaaggtctatgttcaagacatcctgcgg
cagcagctggccagccaggtgctccgtatgctccatgaggagcagggccacctttatgtc
tgtggggatgtgcgtatggcccgggatgtggcccataccctgaagcacctggtggctgcc
aagctgagcctgagtgaggagcaagttgaggactattttttccagcttaagagccagaag
cgctatcatgaagatatctttggtgctgtgtttccctacgaggtgaaaaaagatggtgca
gcaaaacagcccagcgatcccagagttccagcagcccacggaagaagttaa

DBGET integrated database retrieval system