KEGG   Vulpes vulpes (red fox): 112933619
Entry
112933619         CDS       T05911                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04060  Cytokine-cytokine receptor interaction
vvp04061  Viral protein interaction with cytokine and cytokine receptor
vvp04151  PI3K-Akt signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04658  Th1 and Th2 cell differentiation
vvp04659  Th17 cell differentiation
vvp04660  T cell receptor signaling pathway
vvp04672  Intestinal immune network for IgA production
vvp04940  Type I diabetes mellitus
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05162  Measles
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05320  Autoimmune thyroid disease
vvp05321  Inflammatory bowel disease
vvp05330  Allograft rejection
vvp05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112933619 (IL2)
   04151 PI3K-Akt signaling pathway
    112933619 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112933619 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    112933619 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112933619 (IL2)
   04660 T cell receptor signaling pathway
    112933619 (IL2)
   04658 Th1 and Th2 cell differentiation
    112933619 (IL2)
   04659 Th17 cell differentiation
    112933619 (IL2)
   04672 Intestinal immune network for IgA production
    112933619 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112933619 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    112933619 (IL2)
   05321 Inflammatory bowel disease
    112933619 (IL2)
   05330 Allograft rejection
    112933619 (IL2)
   05332 Graft-versus-host disease
    112933619 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    112933619 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112933619 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112933619 (IL2)
   05162 Measles
    112933619 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112933619 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:vvp04052]
    112933619 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:vvp00536]
    112933619 (IL2)
Cytokines and growth factors [BR:vvp04052]
 Cytokines
  Interleukins
   112933619 (IL2)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Haparin
  Cytokines
   112933619 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 112933619
NCBI-ProteinID: XP_025872571
UniProt: A4GT77
LinkDB
Position
Unknown
AA seq 155 aa
MYKMQLLSCIALMLVLVANSAPITSSSTKETEQQMEQLLLDLQLLLNGVNNYENPQLSRM
LTFKFYTPKKATEFTHLQCLAEELKNLEEVLGLPQSKNVHLTDTKELISNMNVTLLKLKG
SETSYNCEYDDETATITEFLNKWITFCQSIFSTLT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaaaatgcaactcttgtcttgcatcgcactgatgcttgtactcgtcgcaaacagt
gcacctattacttcaagctcaacgaaggaaacagagcaacagatggagcaattactgctg
gatttacagttgcttttgaatggagttaataattatgagaacccccaactctccaggatg
ctcacatttaagttttacacacccaagaaggccacagaatttacacaccttcaatgtcta
gcagaagaactcaaaaacctggaggaagtgctaggtttacctcaaagcaaaaacgttcac
ttgacagacaccaaggaattaatcagcaatatgaatgtaacacttctgaaactaaaggga
tctgaaacaagttacaactgtgaatatgatgacgagacagcaaccattacagaatttctg
aacaaatggattaccttttgtcagagcatcttctcaacactgacttga

DBGET integrated database retrieval system