KEGG   Vulpes vulpes (red fox): 112933683
Entry
112933683         CDS       T05911                                 

Gene name
PPARG
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03320  PPAR signaling pathway
vvp04152  AMPK signaling pathway
vvp04211  Longevity regulating pathway
vvp04380  Osteoclast differentiation
vvp04714  Thermogenesis
vvp05016  Huntington disease
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    112933683 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    112933683 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112933683 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    112933683 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    112933683 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112933683 (PPARG)
   05202 Transcriptional misregulation in cancer
    112933683 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    112933683 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    112933683 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112933683 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:vvp03310]
    112933683 (PPARG)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    112933683 (PPARG)
Nuclear receptors [BR:vvp03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   112933683 (PPARG)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Other DBs
NCBI-GeneID: 112933683
NCBI-ProteinID: XP_025872663
UniProt: A0A3Q7TS70
LinkDB
Position
Unknown
AA seq 475 aa
MVDTEMPFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISTPHYEDIPFSRADPMV
ADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPQEEPSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTT
DKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKS
IPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGD
FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggttgacacagagatgccattctggcccaccaactttggaatcagttcagtggatctg
tccgtaatggatgaccactcccattcttttgacatcaagccattcaccactgtggatttc
tccagcatttccactccacactatgaagacattccattctcaagagcggacccgatggtt
gcagattataagtatgatctgaagctccaagagtatcaaagtgcaatcaaagtggagcct
gcatccccaccttattattctgaaaagactcagctgtacaataagcctcaagaagagcct
tccaactccctcatggcaattgaatgccgagtctgtggagataaagcttctgggttccac
tatggagttcatgcttgtgaaggatgcaagggcttcttccggaggacaatcagattgaaa
ctcatttacgatagatgtgacctaaactgtcggatccacaaaaaaagtagaaataaatgt
cagtactgtcggtttcagaagtgccttgctgtggggatgtctcataatgccatcaggttt
gggcggatgccacaggctgagaaggaaaagctgttggcggagatctccagtgatatcgac
cagctgaacccagagtctgctgatctccgggccctggcaaaacatttgtatgactcatac
ataaagtccttcccgctgaccaaagcaaaggcgagagcgatcttgacaggaaagacaaca
gacaaatcaccatttgttatctatgacatgaattccttaatgatgggagaagataaaatc
aagttcaaacacatcacccccttgcaggagcagagcaaagaggtggccattcgcatcttt
caggggtgtcagttccgctcagtggaagccgtgcaggagatcacagagtacgccaaaagt
atccctggttttgtaaaccttgacttgaatgaccaagtaactctgctaaaatatggtgtc
catgagatcatttacacgatgctggcgtccttgatgaataaagacggggttctcatatca
gaaggccaaggattcatgacaagggagtttctaaagagcctgagaaagccctttggtgac
ttcatggagccaaagtttgagtttgctgtgaagttcaatgcactggaattagatgacagc
gacttggcaatatttatagccgtcattattctcagtggagaccgcccaggtttgctgaat
gtgaagcccattgaggacatacaggacaacctgctacaagccttggagctccagctcaag
ctgaaccaccccgagtcctctcagctctttgccaagctgctccagaaaatgacagacctc
agacaaattgtaacagaacatgtgcagctattgcaagtcataaagaaaacagagacagac
atgagtcttcacccactcctacaagagatatacaaggacttgtattag

DBGET integrated database retrieval system