KEGG   Vulpes vulpes (red fox): 112934223
Entry
112934223         CDS       T05911                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04540  Gap junction
vvp04630  JAK-STAT signaling pathway
vvp04810  Regulation of actin cytoskeleton
vvp05160  Hepatitis C
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05226  Gastric cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112934223 (EGF)
   04012 ErbB signaling pathway
    112934223 (EGF)
   04014 Ras signaling pathway
    112934223 (EGF)
   04015 Rap1 signaling pathway
    112934223 (EGF)
   04630 JAK-STAT signaling pathway
    112934223 (EGF)
   04066 HIF-1 signaling pathway
    112934223 (EGF)
   04068 FoxO signaling pathway
    112934223 (EGF)
   04020 Calcium signaling pathway
    112934223 (EGF)
   04072 Phospholipase D signaling pathway
    112934223 (EGF)
   04151 PI3K-Akt signaling pathway
    112934223 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112934223 (EGF)
   04540 Gap junction
    112934223 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112934223 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112934223 (EGF)
   05231 Choline metabolism in cancer
    112934223 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112934223 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112934223 (EGF)
   05212 Pancreatic cancer
    112934223 (EGF)
   05226 Gastric cancer
    112934223 (EGF)
   05214 Glioma
    112934223 (EGF)
   05218 Melanoma
    112934223 (EGF)
   05219 Bladder cancer
    112934223 (EGF)
   05215 Prostate cancer
    112934223 (EGF)
   05213 Endometrial cancer
    112934223 (EGF)
   05224 Breast cancer
    112934223 (EGF)
   05223 Non-small cell lung cancer
    112934223 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112934223 (EGF)
   05165 Human papillomavirus infection
    112934223 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112934223 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:vvp04052]
    112934223 (EGF)
Cytokines and growth factors [BR:vvp04052]
 Growth factors
  Growth factors (RTK binding)
   112934223 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3
Other DBs
NCBI-GeneID: 112934223
NCBI-ProteinID: XP_025873398
UniProt: A0A3Q7TU94
LinkDB
Position
Unknown
AA seq 1211 aa
MLLPLIILWPVVFKCSFASLSDPENWNCPEVSPSGKGSSACVGPAPFLIFSHGISIFRID
LEGTNHEQLVADAGVSVIMDFHYNKERIYWVDPERQLLQRVFLNGTRQERVCNIEKNVSG
MAINWINEELIWSNQQEGIITVTDMKGNNSRVLLSALNYPANVAIDPIERFIFWSSEVAV
AGSLHRADLNGVEEKILLQTSERITAVSLDVLDKQLFWIQYSRDGSNSHIYSCNYDGGSV
HLSKHLTQHNFFAMSLFGNQIFYSTWKKKTIWIANKHSGKDMVRINLDSSFVPPGGIKVV
HPLLQPKAESGTWAPDQKLCKWKQGNCRGSTCGQDSKPYSCTCAEGYTLSQDGKYCEDVN
ECAFWNHGCTLGCENIPGSYYCTCPVGFILLPDGKRCHQLIACPSNTSKCSHDCVLTSDG
PICFCPEGSVLEADGKTCSGCSSPDNGGCSQLCLPLSPVSWECGCFPGYDLQLDKQSCAA
SGPQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVFALDHDPVENKIYFAHTALKWIER
ANMDGSQRERLIEEAVDVPEGLAIDWIDRKFYWTDRGKSLIEGSDLNGKHREIIIKEDIS
QPRGIAVHPMAKRLFWTDMGINPRIESSSLQGIGRLVIASSGLVWPSGITIDYVTDKLYW
CDTKLSVIEMANLDGSKRQRLAQNDVGHPFAMAVFEDHVWFSDWTMPSIIRVDKRTGKNR
VRLRGSMLKPSSLVVVHPLAKPGAQPCLYQNGGCEHICKERFGTAQCSCREGFVKAPDGK
MCLALNGHQIPAVGSEADLSNHVTPGDVLPRSKGFEDNITESQHMLVAEIMVSDADDCAP
VGCSTWAECVSEGENATCQCLKGFTGDGKLCFDIDECEMGITICPPTSSKCVNTEGGYVC
QCSEGYRGDGIHCLDINECQLGMHTCGENATCTNMEGNYTCMCAGSLSEPGQICADSTPP
SHPMEDSHYSVRNGYRECPSSYDGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDLK
WELRHAGQGRQRQVAAVAVGVAVLVLLLLLGLGGAHCYRTKKLSSKNLKNPYEEPSRESS
SSRPSDSEARMASYPQPWFVVIKEHQNLRNGSQPMAVKDGEAADVSRFSSPEPGSVKRTS
WRNEHQLYKDTEQGCCTPPSSNRGTGSQSMEQSFSVTSYEAQPIALGVEKPQSLLSANPY
CNKGPQIHHTK
NT seq 3636 nt   +upstreamnt  +downstreamnt
atgctgctcccccttatcattctgtggccagtagtttttaaatgtagttttgctagtctc
tcagacccggagaactggaactgtcccgaagtctctccctcaggaaaggggagctctgct
tgtgtgggtcctgcacccttcttaattttctcccatggaatcagtatctttaggattgac
ctggaaggcactaatcatgagcaattggtggcagatgctggtgtatcagtgatcatggat
tttcattataataaagaaagaatctattgggtagatccagaaagacaacttttgcaaaga
gtttttctgaatgggacaaggcaagagagagtatgcaatatagagaaaaatgtttcagga
atggcaataaattggataaatgaagagcttatttggtcaaatcaacaggaaggaatcatc
acagtaacagatatgaaaggaaacaattcgcgagttctcttaagcgccttaaactatcct
gcaaatgtagcaattgatccaatagaaaggtttatattttggtcttcagaggtggcagtg
gctggcagccttcacagagcagatctcaatggtgtggaagagaagattcttttacagaca
tcagaaaggataacagctgtgtcattggatgtgcttgataaacagcttttttggattcag
tacagcagagatggaagcaattctcatatttattcctgtaattatgatggaggttctgtc
catcttagcaaacatcttacacagcataatttttttgcaatgtccctttttgggaatcag
atcttctattcaacatggaaaaagaagacaatttggatagctaacaaacacagtgggaag
gatatggttagaattaacctagattcatcatttgtaccacctggtggaatcaaagtagtg
catccactcttacagcccaaggcagagagtggcacttgggcacctgatcagaaactctgc
aaatggaagcaaggtaactgcagaggcagcacgtgtggtcaagattcaaagccctattca
tgcacgtgtgcagagggatatactttaagccaagatggaaaatactgtgaagatgtcaat
gaatgtgccttttggaatcatggctgtactcttgggtgtgaaaacatccctggatcttat
tattgcacatgccctgtaggatttattctgcttcctgatgggaaacggtgtcatcaatta
attgcctgtccgagcaatacatctaaatgtagccatgactgtgttctgacatcagatggt
cccatatgtttctgtcctgaaggctcagtgcttgaggcagatggaaaaacatgtagtggc
tgttcatcacctgataatggtggatgtagccagctctgcctccctctcagcccagtatcc
tgggaatgtggttgctttcctgggtatgacctacaactggacaaacaaagctgtgcagca
tcaggaccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcatttt
gatggaacagattatggaaccctgctcagccagcaaatgggaatggtttttgcccttgat
cacgaccctgtggaaaataagatatactttgcccatacagccctgaagtggatagagaga
gctaacatggacggttcccagcgagaaaggcttattgaggaagcagtggatgtgccagaa
ggtcttgccatagattggattgaccgtaaattctactggacagacagaggaaaatctctt
attgaagggagtgatttaaatggaaaacatcgtgagataatcatcaaggaggacatctct
cagccacgaggaattgctgttcatccaatggccaagagattattctggactgatatgggg
attaatccacgaattgaaagttcttcccttcaaggcattggccgactggttatagctagt
tctggtctggtctggcccagtggaataacgattgattacgtaactgacaaattgtactgg
tgtgataccaagctgtctgtgattgagatggccaatctggatggttcaaaacgccaaaga
cttgcccagaacgatgtaggtcacccatttgctatggccgtgtttgaggatcacgtgtgg
ttctctgattggactatgccatcaataataagggtggacaagaggactggcaaaaacagg
gtacgtctccgaggcagcatgctgaagccttcatcactggttgtagttcatccattggca
aaaccaggagcacagccctgcttatatcaaaatggaggctgtgaacatatttgcaaagag
aggtttggaactgctcaatgttcgtgtcgtgaaggttttgtgaaagccccagatgggaaa
atgtgtctggctctgaatggccatcagatacctgcagtaggtagtgaagcagatctaagt
aatcacgtaacgccaggggatgtcttacccaggagtaaaggatttgaagataacattaca
gaatctcagcatatgctagtggccgaaatcatggtgtcagatgctgacgactgtgctcct
gtgggatgcagtacatgggctgagtgtgtttcagagggagaaaatgccacatgtcagtgt
ttgaaaggatttactggggatggaaaactatgttttgacatagatgaatgtgagatgggc
atcacgatttgccctcccacctcctcaaagtgcgtcaatactgaaggtggctatgtttgc
cagtgctcagaaggctaccgaggcgatgggatccactgtctggatattaatgagtgccaa
ttgggcatgcacacctgtggggaaaatgccacctgtacaaatatggagggaaactatacc
tgcatgtgcgctggcagcctgtctgaacctggacagatatgtgctgactctactccgcct
tctcatcccatggaggatagtcactattctgtgagaaatggttatcgggaatgcccctca
tcctatgatgggtactgcctctataatggtgtgtgtatgtacattgaagcagtcgacaga
tacgcatgcaactgtgtttttggctacgtcggggagcgatgtcagcaccgagacctgaaa
tgggaactgcgccacgcgggccagggccggcagcggcaggtcgccgcggtggccgtgggc
gtggccgtgctcgtcctgctgctgctgctcgggctggggggcgcgcactgctacaggact
aagaagttgtcatcaaaaaatttaaagaatccttatgaagagccaagcagagagagtagc
agtagcaggccttcagacagcgaggccaggatggcctcttatccccaaccttggtttgtg
gttataaaggaacatcaaaatctcaggaatggaagtcaacctatggccgtcaaggatggt
gaggcagcagatgttagccggttttcctctccggagccagggtcagtaaaacggacctca
tggagaaatgaacaccagttatataaggacacagagcaaggctgctgcactccaccatcc
agtaatagaggcaccggctctcagtcaatggagcagagcttttctgtcacctcctatgag
gcacagcccattgctttgggggttgagaagccacagtctctcctatcagctaacccttat
tgcaacaaagggccccagatccaccacaccaaatga

DBGET integrated database retrieval system