KEGG   Vulpes vulpes (red fox): 112934329
Entry
112934329         CDS       T05911                                 

Gene name
STEAP3
Definition
(RefSeq) metalloreductase STEAP3
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    112934329 (STEAP3)
   04115 p53 signaling pathway
    112934329 (STEAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112934329 (STEAP3)
Enzymes [BR:vvp01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     112934329 (STEAP3)
Membrane trafficking [BR:vvp04131]
 Exocytosis
  Others
   Others
    112934329 (STEAP3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct NAD_binding_2 Shikimate_DH 2-Hacid_dh_C IlvN
Other DBs
NCBI-GeneID: 112934329
NCBI-ProteinID: XP_025873538
UniProt: A0A3Q7TUQ0
LinkDB
Position
Unknown
AA seq 487 aa
MSEMDKPLISRRLVDSDGSLAEAPSEAPKVGVLGSGDFARSLVTRLLGSGFSVVVGSRNP
KRTAGLFPSAAQVTFQAEAVDSPDVIFVAMFREHYSSLCGLSDQLAGKILVDVSNPTEQE
HLRRRESNAEYLASLFPTCTVVKAFNVISAWTLQSGPRDGNRQVPICSDHPEAKRAVSEM
VQAMGFMPMDMGSLVSAREVEAMPLRLLPGWKVPALLALGLFIFFYVYNFVRDVLQPYVR
DGKSKFYKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAALQLHRGTKYRRFPDWLDHWLQH
RKQIGLLSFFCAALHALYSFCLPLGRVSRYEVVNLAIKQVLANKSHLWIEEEVWRMEIYL
SLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSTLGFVALVLSTLHTLTYGWTRAFED
SHYKFYLPPTFTLTLLVPCVVILAKGLFLLPCFRHRLSKIRRGWEKDGAIKFTLPMDHAL
AQKTSHV
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgtcagagatggacaagccgctaatcagccgccggctggtggacagtgatgggagcctt
gccgaggcccccagcgaggcccccaaagtcggcgtcctgggcagcggggactttgcccgc
tccctggtcacacgcttgctgggctctggctttagcgtggttgtggggagccgcaacccc
aaacgcacagccgggctgttcccctcagctgcacaagtgaccttccaggcggaggcagtg
gactcccctgatgtcatctttgtggccatgttccgggaacattactcctccctgtgcggt
ctcagtgaccagctagctggcaagatcctcgtggacgtgagcaaccccacggagcaggag
catcttcgtcgccgcgagtccaacgccgagtacctggcttcactcttccccacctgcacg
gtggtcaaggccttcaatgtcatctccgcctggaccctgcagtccggccctagggatggg
aacaggcaggtgcccatctgcagtgaccatccggaagccaagcgggccgtctcagagatg
gtacaggccatgggcttcatgcccatggacatggggtccctggtctcggcccgggaggtg
gaggccatgcccctgcgcctcctcccaggctggaaggtgcctgctctcctggccctgggg
ctcttcatcttcttttacgtctacaacttcgtccgggacgtcctgcagccctacgtgcgc
gatggcaagagcaagttctacaagctccccgtgtccgtggtcaacacgacgctgccgtgc
gtggcctacgtgctgctgtcgctggtgtacctgcccggggtgctggcagccgccctgcag
ctgcaccgcggcaccaagtaccgccgcttccccgactggctggaccactggctgcagcac
cgcaagcagataggcctgctcagcttcttctgcgccgccctgcacgcgctctacagcttc
tgtctgcccctgggccgcgtgagccgctacgaggtggtcaacctcgccatcaaacaggtc
ttggccaacaagagtcacctgtggatcgaggaggaagtctggcggatggagatatacctg
tcactgggcgtgctggcccttggcacgctgtccctgctggctgtcacatcactgccgtcc
attgcaaactcacttaactggagggagttcagcttcgttcagtccacgctgggcttcgta
gccctggtgctgagcaccctgcatacactcacctacggctggacccgcgccttcgaagac
agccattacaagttctatctgccgcctaccttcacgctcacgttgctggtgccctgtgtc
gtgatccttgccaaaggcctgttcctgctgccctgtttccgccacaggctctccaagatc
cggaggggctgggagaaggatggtgccatcaagtttaccctgccaatggaccatgccctg
gcccagaagacgagccacgtgtga

DBGET integrated database retrieval system