KEGG   Vulpes vulpes (red fox): 112934748
Entry
112934748         CDS       T05911                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04390  Hippo signaling pathway
vvp04810  Regulation of actin cytoskeleton
vvp05200  Pathways in cancer
vvp05218  Melanoma
vvp05224  Breast cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112934748 (FGF1)
   04014 Ras signaling pathway
    112934748 (FGF1)
   04015 Rap1 signaling pathway
    112934748 (FGF1)
   04390 Hippo signaling pathway
    112934748 (FGF1)
   04151 PI3K-Akt signaling pathway
    112934748 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112934748 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112934748 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    112934748 (FGF1)
   05218 Melanoma
    112934748 (FGF1)
   05224 Breast cancer
    112934748 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:vvp04052]
    112934748 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:vvp00536]
    112934748 (FGF1)
Cytokines and growth factors [BR:vvp04052]
 Growth factors
  Growth factors (RTK binding)
   112934748 (FGF1)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112934748 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 112934748
NCBI-ProteinID: XP_025874029
UniProt: A0A3Q7ULK2
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALMEKFNLPPGNYMKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacaaccttcactgccctgatggagaagtttaatctgcctccg
gggaattacatgaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagcgcggaaagcgtgggggaggtgtatataaagagcaccgagactggccagtacttg
gccatggacaccgatgggcttctgtacggctcacagacaccgaatgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgctgaaaaa
aattggtttgttggtctcaagaagaatggaagctgcaaacgcggtcctcggactcactat
ggccaaaaagcaattttgtttctccccctgccagtgtcctctgattaa

DBGET integrated database retrieval system