KEGG   Vulpes vulpes (red fox): 112934826
Entry
112934826         CDS       T05911                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112934826 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112934826 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:vvp03310]
    112934826 (NR3C1)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    112934826 (NR3C1)
Nuclear receptors [BR:vvp03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   112934826 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 112934826
NCBI-ProteinID: XP_025874137
UniProt: A0A3Q7TAJ6
LinkDB
Position
Unknown
AA seq 800 aa
MDSKESLSPPSKEEISSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAAASQSDSKQQ
RLLVDFPKGSGSHAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
RLLEESIANLNRSTSVPENPKSSVSAVSAAPTEKEFAQTLSDVSSEQQHLKGQTGTNGGN
VKLYTTDQSTFDIWRKKLQDLDFTSGSPEKEASGSPWRSDLLIDENCLLSPLAGEDDPFL
LEGNSNKDCKPLVLPDTKPKIKDNGDLILASPNSVPLPQVKTEKEDFIELCTPGVIKQEK
LGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPP
IPVGSENWNRCQGSGDDNLASLGTLNFPGRSVFSNGYSRLAVVGLLGRQAHAHWPVGSPG
MRPDVSSPPSSSSAATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLC
AGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATPGASQETSENPAN
KTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKW
AKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSGSMLCFAPDLIINEQRMTLP
CMYDQCKHMLFVSSELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKEL
GKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLNFCFQTFLDKTMSIEFPEMLAEII
TNQIPKYSSGNIKKLLFHQK
NT seq 2403 nt   +upstreamnt  +downstreamnt
atggactccaaggaatcattaagtcccccgagtaaagaagaaatctctagcagtgtgctt
ggtcgggagaggggaaatgtgatggacttctataaaaccctgaggggaggagctactgtg
aaggtttctgcgtcttcaccctcactggctgctgcttctcagtcagactccaagcagcaa
agacttttggttgattttccaaaaggctcaggaagccatgcacagcagccagatctgtcc
aaggcagtttcactctcaatgggattgtatatgggcgagacagaaaccaaagtgatggga
aatgacctgggattcccacaacagggccaaatcagcctttcctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttccagagaacccc
aagagctcagtgtctgctgtttctgctgcccccacagagaaggagtttgcacaaactctt
tctgatgtgtcttcagaacagcaacatttaaaaggccagacgggcaccaatgggggcaac
gtgaagttgtataccacagaccaaagcacctttgacatttggaggaaaaaactccaggat
ttggactttacttctgggtccccagagaaagaggcgagtgggagcccttggagatcagac
ctcttgatagatgaaaactgtttgctctctcctttggcaggagaggacgatccattcctt
ctggaaggaaactcgaacaaggactgtaaacctctcgttttgccggacacaaaacctaaa
attaaggataatggagatctgatcttagccagccccaacagtgtgccactgccccaagtg
aaaacagaaaaagaagatttcattgaactctgcacccctggggtaattaagcaggagaaa
ctgggcccagtttactgtcaggcaagcttttctggggcaaatataattggtaataaaatg
tctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactatgacatg
aatacagcatccctttctcaacagcaggatcagaagcctatttttaatgtcattccacca
attcctgttggttcagaaaattggaataggtgccaaggatctggagatgataacttggct
tccttggggactttgaacttccctggtcggtcggtgttttctaatggctattcaaggctg
gcggttgtgggcctgctaggacgccaagcccatgctcactggccagtgggaagccctgga
atgagaccagatgtcagctctcctccatccagctcctcagcggcaacgggaccacctccc
aaactctgcctcgtgtgttctgacgaggcctcggggtgtcattacggggtcttgacttgt
ggaagctgcaaagtgttcttcaaaagagcggtggaaggtagacaacacaattatctttgt
gctggaagaaatgattgtatcattgataagattcgaagaaaaaactgtccagcatgccgc
tatcggaaatgtcttcaagctgggatgaacttggaagctcgaaaaacaaagaaaaagata
aaaggaattcagcaggccactccaggagcgtcacaagaaacttctgaaaatcctgctaac
aaaacaatagttcctgcaacgttaccacagctcacccctaccctggtgtccctgctggag
gtcattgaacccgaggtgttatacgcagggtatgacagctctgtcccagattcgacttgg
cggatcatgaccacactcaacatgttaggtgggcggcaagtgatcgcagcagtgaaatgg
gccaaggcaataccaggattcaggaacttacacctggatgaccaaatgaccctactgcag
tattcatggatgttcctcatggcatttgccctggggtggagatcatatagacaatcaagt
ggaagcatgctgtgttttgctcctgatctgattattaatgagcagagaatgaccctcccc
tgcatgtatgaccaatgtaaacacatgctgtttgtttcctccgagttacagaggcttcag
gtctcttatgaagagtatctctgtatgaaaaccttactgcttctctcttcagttcctaag
gaaggtttgaagagccaagaactgtttgatgaaattagaatgacctacatcaaagagcta
ggaaaagccattgtcaagagggaagggaactccagccagaactggcaacgcttttatcaa
ctgacaaaactcttggactccatgcatgatgtggttgaaaatctccttaacttttgcttc
caaacatttttggataagaccatgagtattgaattcccagagatgttagctgaaatcatc
accaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaaaag
tga

DBGET integrated database retrieval system