KEGG   Vulpes vulpes (red fox): 112934959
Entry
112934959         CDS       T05911                                 

Gene name
ATR
Definition
(RefSeq) serine/threonine-protein kinase ATR isoform X1
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03460  Fanconi anemia pathway
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04218  Cellular senescence
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    112934959 (ATR)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112934959 (ATR)
   04115 p53 signaling pathway
    112934959 (ATR)
   04218 Cellular senescence
    112934959 (ATR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112934959 (ATR)
   05170 Human immunodeficiency virus 1 infection
    112934959 (ATR)
   05165 Human papillomavirus infection
    112934959 (ATR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112934959 (ATR)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vvp03400]
    112934959 (ATR)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112934959 (ATR)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   112934959 (ATR)
DNA repair and recombination proteins [BR:vvp03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112934959 (ATR)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I THP2
Other DBs
NCBI-GeneID: 112934959
NCBI-ProteinID: XP_025874295
UniProt: A0A3Q7V3R6
LinkDB
Position
Unknown
AA seq 2644 aa
MGDHGLELASMIPALRELGSASPEEYNTVVQKPRQILCQFIDRILTDVNVVALELVKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVNGSQGQNEAKGSCIEFSNWIITRLLRIAATPSCH
LLHKKICEVICSLLFLFKSKSPAIFGVLTKELLCLCEDVICLHRKNAVGHFVEWPVVVSQ
FLSQLDEHMEYLQPAPLQFVNMQNLEFIEVTLLTVLIRIIAIVFFRRQELLLWRIGCVLL
EYGSPKTKSLAISLLTELFELGGLPAQPASTFFSSFLGLLKHLVEMDTDQLKLYEEPLSK
LIKTLFPFETEAYRDIEPVYLNMLLENLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKYV
PAGYESALQVRKVYVRNICKVLVDVLGFQVDAEYLLGPLYAALKMESMEIIEEVQCQIQQ
ENLSSNSDGISAKRRRLSSSLNSSKRPPKQTEEIKHVDMNKKSILWSALKQKAESLQIFL
EYNGLKNPVIATLEGITIVLQLTALCTVHCSHHNMDCHNFRDCRQKCKKKPSVEITWMSL
DFYTKVLKSCRSLLESVQKPDLEAVIDKVVKIYDALIYIHMKTSFEDHILEDLCGMLSLP
WIHSHSDDGSLKLTTFATNLLALSQRISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAIYS
WALQSSHEVIRASCVNGFFILLQQQNSCNRVPKILIDKVKDDSDFVKREFASILGQLVCT
LHGMFHLTSSLTEPFSEHGHTDLFCKNLKVASQHECSSSQLKASICKPFLFLLRKKTPSP
VKLAFIDNLYHLCKHLDFREDETDVKTVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDS
EDGFIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLL
SKSASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPSTPCQNA
EMRKQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTL
GKQLNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHN
ELLLRIGEHYQQVFNGLSILASFASSDDPYQGPREITSPELMADYLQPKLLGILAFFNMQ
LLSSSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWD
CFVRCLDHAYLGSLLSHVIVALLPLIHIQPEETAAIFHYLIIENRDAVQDFLHEIYFLPD
HPELKKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEK
LIKYATDSETVEPVISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTESQ
GKDFTFVTGVEDSSFAFGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMQTDG
PGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGNNFAEWSASWAGY
LITKVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLK
HDDQHTISTQDSASDLCQLSTQTVFSMLDHLTQWARHKFQALNAEKFPQSKSNRDKIDSV
ASTADYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQ
KLYAAMHEPDGVAGVSAIRKAEPSLKEQILEHESIGLLRDATACYDRAIQLEPDQIIHYH
GVVKSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKS
TTWSVRLGQLLLSAKKRDTTAFYDTLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHML
CELEHSIKPLFHQSPGDSSQEDSLNWAARLEMTQNSYRAKEPILALRRALLSLNKRPDYN
EMVGECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQ
KGVELCFPENKTPTESKNMLIHGRAMLLVGRFMEETANFESNAVMKKYKDVTLFLPEWED
GHFYLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLSLWLDF
GAKAYEWEKAGRSDRVQMRNDLAKINKVITEHTNHLAPYQFLTAFSQLISRICHSHDEVF
VVLMEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFIGDATR
LTDKLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEPTFSEILIPLQSVMIPTLPSIPGAH
ANHEPFPGHWAYIASFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLME
FNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVY
MTGKELRQCMLPKAAALSEKLKVFREFLLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRS
TAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV
NGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNET
GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGW
TPYM
NT seq 7935 nt   +upstreamnt  +downstreamnt
atgggcgaccacggcctggagctggcgtctatgatccccgctctgcgggagttgggcagt
gccagtccagaagaatataatacagttgtacagaagccaagacaaattttatgtcagttc
attgaccgaatacttacagatgtaaatgttgttgctctagaacttgtaaagaaaactgac
tctcagccaacctctgtgatgttgcttgatttcatccagcatataatgaagtcctcccca
cttatgtttgtaaatgtgaatggaagccaagggcaaaatgaggccaaaggcagttgtatt
gaattcagtaattggatcataacgagacttctgcggattgcagcaactccatcctgtcac
ttgttacacaagaaaatctgtgaagttatctgctcattattatttctttttaaaagcaag
agccctgcaatttttggagtactgacaaaggaattactctgtctttgtgaagatgtgatt
tgcctccacagaaaaaatgcagtgggacactttgtggaatggccagtggtagttagccaa
tttttaagtcaattagatgaacacatggaatacttacagccagctcctttgcagttcgtg
aacatgcaaaatttagaatttattgaagtcactttattaacagttcttattcgtattatt
gcaattgtgttttttagaaggcaagaactcttactttggcggattggttgtgttctgcta
gaatatggtagtccaaaaactaaatccctagcaattagccttttaactgaactctttgag
cttggagggttaccagcacaaccagccagcactttcttcagctcatttttgggattatta
aaacatcttgtagaaatggatacagaccagttgaaactctatgaagaaccattatcaaag
ctgataaaaacactattcccctttgaaacagaagcttatagagatattgagcctgtctat
ttaaatatgctgctggaaaacctctgtgtcatgtttgaagatggtgtgcttatgcggctt
aagtctgatttgctaaaagcagctttgtgccacttactgcagtatttccttaaatatgtg
ccagctgggtatgaatctgctttacaagtcaggaaggtttatgtgagaaacatttgtaaa
gttcttgtggatgtgcttggatttcaggtggatgcagagtatttgttgggcccactttat
gcagccttaaaaatggaaagtatggaaatcattgaggaggttcagtgtcaaattcaacag
gaaaacctcagcagtaatagtgatggaatatcagccaaaagacgtcgactcagctcatct
ctgaactcttccaaaagaccaccgaaacagactgaggaaattaaacatgtggatatgaac
aaaaagagcattttatggagtgcactgaaacagaaagctgaatcccttcagattttcctt
gaatacaatggtctaaagaatcctgttattgcaactttagaaggaatcactattgtcctt
caactgactgctctatgtactgttcattgttcgcatcataacatggactgccataatttt
agggactgtcgtcagaaatgtaagaagaaaccttcagtagagataacttggatgtctttg
gatttttacacaaaagtgcttaagagctgtagaagtttgttagaatctgttcagaaacct
gacctggaggcagttattgataaagtggtgaaaatatatgatgctctgatttatattcac
atgaaaacttcatttgaagatcatattctagaagatttatgtggaatgctctcacttccg
tggattcattctcattctgatgatgggtctttaaagttgaccacatttgccactaatctt
ttagcattaagccagaggatttcagatagctactcaccacaggcacagtcacggtgtgtg
tttcttctaactttgtttccaagaagaatattccttgaatggagaacagcaatttatagc
tgggccctacagagctcccatgaagtaatccgggctagttgtgttaatggattttttatc
ttattgcagcagcaaaattcatgtaacagagttcccaagattcttatagataaagtcaaa
gatgattctgactttgtcaagagagaatttgcctctattcttggtcaacttgtctgtaca
cttcatggcatgtttcatttgacaagttccttaacagaacctttctctgaacatggacat
actgaccttttctgtaaaaatctaaaagttgcatctcaacatgaatgttcatcttctcaa
ctaaaagcttccatttgcaagccattccttttcctattgagaaaaaaaacacctagtcca
gtgaaacttgctttcatagataatctatatcatctttgtaagcatcttgattttagagaa
gatgaaacagatgtgaaaacagttcttggaaccttattaaatttaatggaagatccagac
aaggatgttagagtggcttttagtggaaatatcaagcatatattggaatccttagactct
gaggatggatttataaaagagctttttgtcttaagaatgaaggaagcatatacacatgct
caaatctcaagaaataatgagttgaaggataccttgattcttacaacaggggatattgga
agagcagcaaaaggagatttggtaccttttgcacttttgcacttattgcattgtttatta
tccaagtcagcatctgtctctggagcagcatatacagaaatcagagctctagttgcagct
aagagtgttaaactacaaaactttttcagccagtataagaaacccatctgtcagttttta
gtagagtccctccattccagtcagatgacagcgcttcctagtactccatgccagaatgct
gagatgcggaaacaagatgtggctcaccagagagaaatggctttaaataccttgtctgaa
attgccaatgtttttgactttcctgatcttaatcgtttccttactaggacattacaagtt
ctgctccctgaccttgctgccaaagcaagccctgcagcttctgctctcattcgaacttta
ggaaaacaattaaatgtcaatcgtagagagattttaataaataacttcaaatatattttt
tctcatttggtctgttcctgttccaaggatgaattagaacgtgcccttcattatctaaag
aatgaaacagaaattgaactggggagtctattgagacaagatttccaaggattgcataat
gaattattgctacgtattggagaacactatcaacaggttttcaatggtttgtcaatactt
gcctcatttgcatctagtgatgatccatatcagggccccagagagatcacatcacctgaa
ctaatggctgattatttgcaacctaagttgttgggcattttggctttttttaacatgcag
ctactaagctccagtgttggcattgaagataagaaaatggctttgaacagtttgatgtct
ttgatgaagttgatgggaccaaaacacgtcagctccgtgagggtgaagatgatgaccaca
ctaagaactggcctgagattcaaggatgattttcctgaattgtgttgcagggcttgggat
tgctttgttcgttgcctggatcatgcttatcttggttcccttctcagtcatgtgatagta
gctttgttacctctcatacacatccagcctgaagaaactgctgctatatttcactacctc
ataattgaaaacagggatgctgtacaagatttccttcatgaaatatactttttacctgat
catccagaattaaaaaagataaaagcagttctacaggagtacagaaaggagacctctgag
agtacagatcttcagacaactcttcaactatccatgaaagcaattcagcatgaaaatgta
gacgttcgtattcatgctcttacgagcttgaaggaaactttgtataaaaatcaggaaaag
ctgataaaatatgcaacagatagtgaaacagtggaacctgttatctcacagttggtgaca
gtgcttttgaaaggttgccaagatgcaaactcccaagctcggttgctctgtggggagtgt
ttaggggaactgggggcaatagatccaggtcgactagatttctcaacaactgaaagccaa
gggaaagattttacatttgtgacgggagtagaagattcaagctttgcctttggattattg
atggaactaactagagcttaccttgcatatgcagataacagccgggctcaagattcagct
gcttacgccattcaggagttactttctatttatgactgcagagagatgcagaccgatggt
ccaggtcaccaattgtggaggagatttcctgagcatgttcgggaaatcctggaacctcat
ctaaatactagatataagagctctcagaagtcaacagattggtctggagtaaagaagcca
atttacttaagtaaattaggtaataactttgcagaatggtcagcatcttgggcaggttat
cttataacaaaggttcggcatgatcttgccagtaaaatcttcacttgctgtagcattatg
atgaaacatgatttcaaggtgaccatctatcttcttccacatattctagtatatgtcttg
ttgggttgtaatcaagaagatcagcaagaggtttatgcagaaattatggcagttctaaag
catgatgatcagcataccataagtacccaagacagtgcatctgatctgtgtcaactcagt
acacagactgtgttctccatgcttgaccatctaacacaatgggcaaggcacaaatttcag
gcactgaatgcagagaaatttccacaaagcaaatcaaacagagataagatagactcagta
gcatctacggcggattatgaagactatcagagtgtaactcgttttctagaccttatacct
caggataccctcgcagtagcttcctttcgctccaaagcatacacacgagctgtaatgcac
tttgaatcatttattacagaaaagaaacaaaatattcaagagcatcttggatttttacag
aaattgtatgctgctatgcatgaaccggatggagtggctggagtaagtgcaattcgaaag
gcagaaccatctttgaaagaacagatccttgaacatgaaagtattggcttactgagggat
gctactgcttgttatgacagggctattcagctagaaccagaccagatcattcattatcat
ggtgtagtgaagtccatgttaggtcttggtcagttgtctactgtaatcactcaggtgaat
ggagtgcatgctaacagatctgaatggacagatgaattaaacacatatagagtggaagca
gcctggaaattgtcacagtgggatttggtggaaaactatttggcagcagatgggaaatct
acaacatggagtgtcagactgggacagttactattatcagccaagaaaagagataccaca
gctttttatgacactctgaaactagtgagagcagaacaaattgtacctctttcagctgca
agctttgaaagaggctcttatcaacgaggatatgaatatattgtaagattgcacatgttg
tgtgagttggagcatagcatcaaaccactctttcaccagtcgccaggtgacagttctcaa
gaagattctctcaactgggcagctcgactagaaatgacacaaaattcctacagagctaag
gagcccatcctggctctccggagagctttattaagcctcaacaaaagaccagattacaat
gaaatggttggagaatgttggctacagagtgccagagtagctagaaaggctggtcaccac
cagacagcctacaatgctctccttaatgctggagaatcaagacttgctgaactatatgtg
gagagggcaaagtggctatggtctaagggtgatgttcaccaggcactaattgttcttcag
aagggtgttgaattatgttttcctgaaaataaaaccccaaccgagagtaagaacatgtta
atccatggtcgagctatgctactagtgggccgatttatggaagaaacagctaactttgaa
agcaatgcagttatgaaaaaatacaaggatgtgaccttgttcttgccagaatgggaggat
ggacatttttaccttgccaagtactatgacaaattgatgcccatggtcacagacaacaaa
atggaaaagcaaggtgatctcattcggtatatagttcttcattttggcagatctctacaa
tatggaaatcaattcatatatcagtcaatgccacgaatgttatcactatggcttgatttt
ggtgctaaggcatacgaatgggaaaaagctggccgttctgatcgtgtacaaatgagaaac
gatttagccaaaataaacaaggttatcacagagcacacaaatcacttagcaccatatcag
tttttgactgctttttcacagttgatctctcgaatttgtcattctcatgatgaagttttt
gttgtcttgatggaaattatagccaaagtgtttctggcctatcctcaacaagcaatgtgg
atgatgacagctgtgtcaaagtcttcttatcccatgcgtgtgaacagatgcaaggaaatc
ctaaataaagctattcatatgaaaaaatccttagaaaaatttattggagatgcaactcgc
ctaacagataagcttttggaattgtgcaataaaccggtggatggaagtagttccacatta
agcatgagcactcattttaaaatgcttaaaaagctggtggaagaaccaacatttagtgaa
attctcattcctttacaatcagtcatgatacctactcttccatcaattccgggtgctcat
gccaaccatgagccatttcctgggcattgggcctatattgcaagctttgatgatatggtg
gaaattcttgcttctcttcagaaaccaaagaagatctctttgaaaggatcagatggaaag
ttctacatcatgatgtgtaagccaaaagatgacctgagaaaggattgtaggctaatggaa
ttcaattccttgattaataagtgtttaagaaaagatgcagaatctcgtagaagagaactt
catatccgaacatatgcagttattcccctgaatgatgaatgtggaattattgaatgggtt
aacaacactgctggcttgagacctattttgaccaaactttataaggaaaagggagtttat
atgacaggaaaagaacttcggcagtgtatgctaccaaaagctgcagctttgtctgaaaaa
ctcaaagtattccgagaatttctcctacccagacatcctcccgtttttcatgaatggttt
ctgaggacattccctgatcctacatcatggtacagtagcagatcagcatactgccgttct
actgcagtgatgtcaatggttggttatatcctggggcttggagaccgtcatggtgaaaac
attctctttgattctttaactggtgaatgtgtacatgtggatttcaactgtcttttcaat
aagggagaaacctttgaagttccagaaattgttccatttcgactgactcataatatggtt
aatggaatgggtcctatgggaacagaaggtctttttcgaagagcttgtgaagttacaatg
aggctgatgcgagatcaaagagagcctttaatgagtgtcttaaaaacttttctacatgat
cctcttgtggaatggagtaaaccagtgaaaggacactccaaagcaccactgaatgaaact
ggggaggttgtcaatgaaaaggccaagacccatgttcttgacatcgagcagcgactgcaa
ggtgtaatcaagacccgaaatagagtgacagggctgccattatctattgaaggacatgta
cattaccttatacaagaagctactgatgaaaacttactgtgtcaaatgtaccttggttgg
actccatatatgtga

DBGET integrated database retrieval system