KEGG   Vulpes vulpes (red fox): 112935070
Entry
112935070         CDS       T05911                                 

Gene name
ABCB1
Definition
(RefSeq) multidrug resistance protein 1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp02010  ABC transporters
vvp04976  Bile secretion
vvp05206  MicroRNAs in cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    112935070 (ABCB1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    112935070 (ABCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112935070 (ABCB1)
  09162 Cancer: specific types
   05226 Gastric cancer
    112935070 (ABCB1)
Enzymes [BR:vvp01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     112935070 (ABCB1)
Transporters [BR:vvp02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    112935070 (ABCB1)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112935070 (ABCB1)
CD molecules [BR:vvp04090]
 Proteins
  112935070 (ABCB1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 ABC_ATPase AAA_22 Rad17 RsgA_GTPase Zeta_toxin G-alpha AAA AAA_5 AAA_29 AAA_7 AAA_14 APS_kinase DUF815 PRK AAA_30 AAA_15 AAA_24 NTPase_1 NEMP
Other DBs
NCBI-GeneID: 112935070
NCBI-ProteinID: XP_025874451
UniProt: A0A3Q7U962
LinkDB
Position
Unknown
AA seq 1281 aa
MDPEGGRKGRAEKNFWKTGKKSKKNEKKEKKPTVSTFAMFRYSNWLDRLYMLVGTMAAII
HGAALPLMMLVFGDMTDSFANAGISRNTTFPVIINGSIMNNTQPFINHLEEEMTTYAYYY
SGIGAGVLVAAYIQVSFWCLAAGRQILKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDD
VSKINEGIGDKIGMFFQSITTFFTGFIVGFTRGWKLTLVILAISPVLGLSAAIWAKILSS
FTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANIS
IGAAFLLIYASYALAFWYGTSLVLSNEYTIGQVLTVFFSVLIGAFSIGQASPSIEAFANA
RGAAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFKNVHFSYPSRKEVKILKGLNLKVQ
SGQTVALVGNSGCGKSTTVQLMQRLYDPTDGMVCIDGQDIRTINVRHLREITGVVSQEPV
LFATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPNKFDTLVGERGAQLSGGQKQR
IAIARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVI
AGFDDGVIVEKGNHDELMKEKGIYFKLVTMQTRGNEIELENATGESKSESDASEMSPKDS
GSSLIKRRSTRRSIHAPQGQDRKLGTEEDLNENVPPVSFWRILKLNSTEWPYFVVGIFCA
IINGGLQPAFSIIFSRIIGIFTRNEDPETKRQNSNMFSVLFLVLGIISFITFFLQGFTFG
KAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQ
NIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGAGKIAT
EAIENFRTVVSLTREQKFEYMYAQSLQVPYRNSLRKAHIFGVSFSITQAMMYFSYAGCFR
FGAYLVANKFMNFQDVLLVFSAIVFGAMAVGQVSSFAPDYAKAKVSAAHVIMIIEKSPLI
DSYSPHGLKPNTLEGNVTFNEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKST
VVQLLERFYDPLAGSVLIDGKEIKHLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSR
VVSHEEIVQAAKEANIHHFIETLPEKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILL
LDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGKVKEHGTHQ
QLLAQKGIYFSMVSVQAGAKR
NT seq 3846 nt   +upstreamnt  +downstreamnt
atggatcctgaaggaggccgtaaggggagagcagagaagaacttctggaaaacgggcaaa
aaaagtaaaaaaaatgagaagaaagaaaagaaaccaactgtcagcacgtttgcaatgttt
cgctattcaaattggcttgataggttgtatatgttggtggggacaatggctgccatcatc
catggagctgcactccctctcatgatgctggtttttggagacatgacagatagctttgca
aatgcaggaatttcaagaaacacaacttttccagttataattaatggaagtattatgaac
aatacacaacctttcatcaaccatctggaggaggaaatgaccacgtatgcctattattac
agtgggatcggtgctggcgtgctggtggctgcttacatccaggtttcattctggtgcctg
gcagcaggaagacagatactcaaaattagaaaacaattttttcatgctatcatgcgacag
gagattggctggtttgacgtgcatgatgttggggagcttaacacccggctcacagacgat
gtctccaaaatcaatgaaggaattggcgacaaaattggaatgttctttcaatcaataaca
acatttttcaccggttttatagtggggtttacacgtggttggaagctaacccttgtgatt
ttggccattagccctgttcttggactttcagccgccatctgggcaaagatactatcttca
tttactgataaagaactcttggcctatgcaaaagctggagcagtagctgaagaagtctta
gcagcaatcagaactgtgattgcctttggaggacaaaagaaagaacttgaaaggtacaac
aaaaatttagaagaagctaaaagaattgggataaagaaagctatcacggccaacatttct
attggtgccgctttcttattgatctatgcatcatatgctctggctttctggtatgggacc
tccttggtcctctccaatgaatatactattggacaagtactcactgtcttcttttctgta
ttaattggggcttttagtattggacaggcatccccaagcattgaagcatttgcaaatgca
agaggagcagcttatgaaatcttcaagataattgacaataaaccaagcattgacagctat
tcgaagagtggacataaaccagataacattaagggaaatttggaattcaaaaatgttcac
ttcagttacccttctcgaaaagaagttaagatcttaaagggtctcaacctgaaggttcag
agtgggcagacagtggcgctggttgggaacagtggctgcgggaagagcacgaccgtgcag
ctgatgcagaggctctatgaccccacagatggcatggtctgtattgatggacaggacatt
aggaccataaatgtaaggcatcttcgggaaattactggtgtggtgagtcaggagcctgtg
ttgtttgccaccacgatagctgaaaacattcgctatggccgcgaaaatgtcaccatggat
gagattgagaaagctgttaaggaagccaatgcctatgattttatcatgaaactacctaat
aaatttgacactctggttggagagagaggggcccagctgagtggtggacagaaacagaga
attgccatcgctcgggccctggttcgcaaccccaagattcttctgctggatgaggcaacg
tcagctctggacactgaaagtgaagcagtggttcaggtggccctggataaggccagaaaa
ggccggaccaccattgtgatagctcatcgtttgtctacagttcgtaatgccgatgtcatc
gctggttttgatgatggagtcattgtggagaaaggaaatcatgatgaactcatgaaagaa
aagggcatttacttcaaactggtcacaatgcagacaagaggaaatgaaattgagttagaa
aatgccactggtgaatccaaaagtgaaagtgatgcctcggaaatgtctccaaaagattca
gggtccagtttaataaaaagaagatcaactcgcaggagtatacatgcaccacaaggccaa
gacagaaagcttggtacagaagaggacttgaatgagaatgtacctccagtatccttctgg
aggattctgaagctgaattcaactgaatggccttattttgtggttggtatattttgtgct
attataaacggaggcctgcaaccagcattttcaataatattttcaaggattatagggatc
tttacccgaaatgaggatcctgaaacaaaacgacagaatagtaacatgttttctgtattg
tttctagtccttggaattatttcttttattacatttttcctccagggcttcacatttggc
aaagctggggagatcctcactaagcggcttcgatacatggttttcagatccatgctgaga
caggatgtcagctggtttgatgaccctaaaaacaccactggagcattgacaaccaggctt
gccaatgatgcggctcaagttaaaggggctataggttccaggcttgctgtcattacccag
aatatagcaaatcttgggacaggcattattatatccttaatctatggctggcaattaaca
cttttactcttagcaattgtacccatcattgcgatagcgggagttgttgaaatgaaaatg
ttgtctggacaagcactgaaagataagaaagaactagaaggagctgggaagattgctaca
gaagccatcgaaaacttccggactgttgtttctttgactcgggagcagaagtttgaatac
atgtatgcacagagtttgcaagtaccatacagaaactctttgaggaaagcacacatcttc
ggggtctcattttctatcacccaggcaatgatgtatttttcctatgctggctgtttccgg
tttggtgcctacttggtggcaaataagttcatgaactttcaggatgttcttttggtattc
tcagctattgtctttggtgccatggcagtggggcaggtcagttcatttgctcctgactat
gccaaagccaaagtatcagcagcccacgtcatcatgatcattgaaaaaagccctctgatt
gacagctacagccctcacggcctcaagccaaatacgttggaaggaaatgtgacatttaat
gaggtcgtgttcaactatcccactcgaccagacatccccgtgctccaggggctgagcctc
gaggtgaagaagggccagacgctggccctcgtaggtagcagtggctgtgggaagagcaca
gtggttcagctcctagagcgcttctatgaccccttggctggttcagtgctaattgatggc
aaagagataaagcacctgaatgtccagtggctccgagcacacctgggcatcgtgtctcag
gagcccatcctgtttgactgtagcattgccgagaacattgcctatggagacaacagccgg
gtcgtatcacatgaagagatcgtgcaggcagccaaggaggccaacatacaccacttcatc
gagacactccctgagaaatacaacaccagagtaggagacaaaggaacccagctctctggt
ggccagaaacagcgcattgccatagctcgcgctcttgttagacagcctcatattttgctt
ttggatgaagctacatcagctctggatacagaaagtgaaaaggttgtccaagaagccctg
gacaaagccagagaaggccgcacctgcattgtgatcgcccaccgcttgtccaccatccag
aatgcagatttaatagtggtgtttcagaatggcaaagtcaaggagcatggcacacatcaa
cagctgctggctcagaaaggcatctatttttccatggtcagtgtccaggctggagcaaag
cgctag

DBGET integrated database retrieval system