KEGG   Vulpes vulpes (red fox): 112935246Help
Entry
112935246         CDS       T05911                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00010  Glycolysis / Gluconeogenesis
vvp00053  Ascorbate and aldarate metabolism
vvp00071  Fatty acid degradation
vvp00280  Valine, leucine and isoleucine degradation
vvp00310  Lysine degradation
vvp00330  Arginine and proline metabolism
vvp00340  Histidine metabolism
vvp00380  Tryptophan metabolism
vvp00410  beta-Alanine metabolism
vvp00561  Glycerolipid metabolism
vvp00620  Pyruvate metabolism
vvp01100  Metabolic pathways
Module
vvp_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112935246 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    112935246 (ALDH2)
   00620 Pyruvate metabolism
    112935246 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112935246 (ALDH2)
   00561 Glycerolipid metabolism
    112935246 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    112935246 (ALDH2)
   00310 Lysine degradation
    112935246 (ALDH2)
   00330 Arginine and proline metabolism
    112935246 (ALDH2)
   00340 Histidine metabolism
    112935246 (ALDH2)
   00380 Tryptophan metabolism
    112935246 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112935246 (ALDH2)
Enzymes [BR:vvp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     112935246 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 112935246
NCBI-ProteinID: XP_025874684
UniProt: A0A3Q7TBX9
LinkDB All DBs
Position
Unknown
AA seq 521 aa AA seqDB search
MLRAAALAAAGLRPRLGRRLLSAASSQAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPT
INPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLRCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVIVMKVAEQTPLTALYVANLIKEAGFPPGVVN
IIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGNSNLKRVTLELGGKSPNIIMS
DADMNWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVERSVARAKSRVVGNPFDSQT
EQGPQVDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGFFIQPTVFGDVQDSMTIAKEE
IFGPVMQILKFKTIEEVIGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVF
GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTIKVPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgccgccgcgctcgctgccgccggcctccggccccggctgggccgccgcctc
ctgtcggccgcctcctcccaggccgtgccggcccccaaccagcagcccgaagtcttctac
aaccagatcttcataaacaatgagtggcacgatgctgtcagcaagaaaacgttccccacc
atcaatccatccactggagaagtcatctgtcaggtagctgaaggagataaggaagatgtg
gacaaggcagtaaaggctgcccgggctgccttccagctaggttcaccctggcgccgcatg
gacgcatccgacagaggccgcttgctgaaccgcctggcagatctgattgagcgagaccgg
acctatctggcagccttggagaccctggataatggcaagccctatgtcatctcttacctt
gtggatctggacatggtcctcagatgcctccgttactatgctggctgggctgataagtac
catgggaaaaccattcctatcgatggggactttttcagttatacccgccatgaacctgtc
ggggtgtgcgggcagatcattccgtggaacttccccctcctgatgcaagcctggaaactg
ggcccagctctggcgactggaaatgtgattgtgatgaaggtagctgagcagactccactc
actgccctctatgtggccaacctgattaaggaggctggctttcctcctggcgtggtcaat
attattcctggatttggccccacagctggggctgccatcgcctcccacgaggatgtggac
aaagtggccttcacaggctccaccgaggttggccacctaatccaggttgctgcagggaac
agtaaccttaagagagtgaccctggagctgggaggaaagagccccaatatcatcatgtca
gatgcagacatgaactgggccgtggagcaggcccactttgccctgttcttcaaccagggc
cagtgctgctgtgccggctcccggacctttgtgcaagaagatgtttatgctgagtttgtg
gagcggagtgttgccagggccaagtcgcgtgtagttgggaacccctttgacagccagact
gagcaggggccgcaggtggatgaaactcagtttaagaagatccttggttatatcaaatct
gggaaggaggagggggcgaaactattgtgtggtggaggggcggctgctgaccgaggcttc
tttatccagcccaccgtgtttggagatgtgcaagacagcatgactatcgccaaggaggag
atctttgggccagtgatgcagatcctgaagttcaagaccatagaggaagttattgggaga
gccaataattccaagtatgggctggctgcagctgtcttcaccaaggacttggacaaagcc
aattatctgtcccaagccctccaggctggcactgtgtggatcaactgctatgatgtattt
ggggcccagtcaccattcggtggctacaagatgtctgggagtggccgggagctgggagag
tatgggttgcaggcatacacggaagtgaaaactgtcacgatcaaagtgcctcagaagaac
tcctaa

DBGET integrated database retrieval system