KEGG   Vulpes vulpes (red fox): 112935451Help
Entry
112935451         CDS       T05911                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00020  Citrate cycle (TCA cycle)
vvp00190  Oxidative phosphorylation
vvp01100  Metabolic pathways
vvp01200  Carbon metabolism
vvp04714  Thermogenesis
vvp04932  Non-alcoholic fatty liver disease (NAFLD)
vvp05010  Alzheimer disease
vvp05012  Parkinson disease
vvp05016  Huntington disease
Module
vvp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vvp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vvp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112935451 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    112935451 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    112935451 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112935451 (SDHA)
   05012 Parkinson disease
    112935451 (SDHA)
   05016 Huntington disease
    112935451 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    112935451 (SDHA)
Enzymes [BR:vvp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     112935451 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 112935451
NCBI-ProteinID: XP_025874961
UniProt: A0A3Q7UAJ3
LinkDB All DBs
Position
Unknown
AA seq 665 aa AA seqDB search
MSGVRAVSRLLGARRLALTRAQWPAAWQTGSRSFHFTVDGNKRSSAKVSDSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAIRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KIPPIKPNAGEESVMNLDKLRFANGSVRTSELRLNMQKSMQNHAAVFRVGSVLQEGCEKI
SQLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKV
RIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDIKTGKVSLEYRPVIDRTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccgggcggtgtctcggctgctgggcgcccggcgcctggcgctgaccaga
gcacagtggccggcggcatggcagacaggctcccgcagttttcacttcaccgttgatggg
aataagaggtcctctgctaaagtttcagattcaatctctacgcagtacccagtggtggac
catgaatttgatgcagtggtggtaggcgctggaggggcgggcttgcgagctgcatttggc
ctttcggaggctgggtttaacacggcctgcgtcacaaagctctttcccaccagatcacac
accgttgctgcccagggaggaatcaatgctgctctgggaaacatggaggaggacaactgg
aggtggcacttctacgacactgtgaagggctccgactggctgggggaccaggacgccatc
cactacatgacagagcaggcccctgcttctgtggtagagctggagaattatggcatgccg
tttagcagaactgaagatggaaggatctatcagcgtgcttttggtggacagagcctcaag
tttgggaaaggcgggcaggcccatcggtgctgctgtgtggctgaccgcactggccactcg
ctgctgcacacgttgtatggaaggtctctgcggtatgataccagctattttgtagagtac
tttgccttggatctcttgatggaaaatggagaatgtcgtggtgttattgcactatgcata
gaagatgggtccatccatcgcataagagccaagaacactgttgtggctaccggaggttat
ggccgcacctacttcagctgcacgtctgcccacaccagcaccggtgacggcaccgccatg
gtcaccagggcaggccttccctgccaggacttggagtttgttcagttccaccccacaggt
atatatggtgctggttgtctcattacggaaggatgccgtggagagggaggcattctcatt
aacagtcaaggcgaaaggttcatggagcgatatgccccagttgcaaaggacctggcatcc
agagacgttgtatctcggtccatgactctggaaatccgtgaaggcagaggctgtggcccc
gaaaaagaccatgtgtacctgcagttgcaccacctaccccccgagcagttggccatacgt
ctgcctggcatttcagagacggccatgatctttgccggtgtggatgttaccaaggagcca
atccccgtccttcccactgtgcattataacatgggtggcattcccaccaactacaagggg
caggttctgaggcacgtgaatggccaggatcagatcgtgcctggcctgtatgcatgcggg
gaggccgcctgcgcctcggtgcacggtgccaaccgcctcggagccaactcgctcttggac
ttggtcgtctttggccgggcatgtgccctgagtatcgcagagtcctgcagacctggagat
aaaattcccccgattaaaccaaatgccggggaagagtctgtcatgaatcttgacaaactg
agatttgccaacggaagtgtaagaacatctgaactacgactcaacatgcagaagtcgatg
cagaatcatgctgctgtgttccgtgtgggaagtgtgttacaggaaggctgtgagaaaatc
agccagctctatggagacctaaagcatctgaagacatttgaccgaggaatggtctggaac
accgacctggtagagaccctggagctgcagaacctgatgctctgtgcacttcagaccatt
tatggagcagaggcccggaaggagtcacgtggcgctcacgccagggaagattacaaggtg
cggattgacgagtatgattactctaagcccatccaggggcagcagaagaagccgtttgag
gagcactggagaaagcacaccctttcctacgtcgatatcaagactgggaaggtctcattg
gaatatagacctgtgatcgacagaactttaaatgaggctgactgtgccacggtccctcca
gccattcgctcctactga

DBGET integrated database retrieval system