KEGG   Vulpes vulpes (red fox): 112935454
Entry
112935454         CDS       T05911                                 

Gene name
TERT
Definition
(RefSeq) telomerase reverse transcriptase
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112935454 (TERT)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112935454 (TERT)
   05226 Gastric cancer
    112935454 (TERT)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112935454 (TERT)
   05165 Human papillomavirus infection
    112935454 (TERT)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     112935454 (TERT)
DNA replication proteins [BR:vvp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    112935454 (TERT)
   Telomerase complex (fungi)
    112935454 (TERT)
SSDB
Motif
Pfam: Telomerase_RBD RVT_1
Other DBs
NCBI-GeneID: 112935454
NCBI-ProteinID: XP_025874965
UniProt: A0A3Q7V5S1
LinkDB
Position
Unknown
AA seq 1057 aa
PAAPSFRQVSCLKELVARVVQRLCERGARNVLAFGFGLLDGARGGPPVAFTTSVRSYLPN
TVTETLRGSRAWGLLLRRVGDDVLTHLLARCALYLLVAPSCAYQVCGPPLYDLCAPAASL
PLPAPGLPGLPGLPGLPGLGASADLRPTRQAQNSGARRRRDSPGTSVPLAKRPRRSVASE
PERGAHRSFPRAQQPRVSEAPAVTPAEAASPAASWEGGPPGTRPTTPAWHPSPGPQGAPH
DPAHPETKHFLYCSGGRERLRSSFLLSALPPTLSGARKLVETIFLSSAPQKPGAARRMRR
LPARYWRMRPLFQELLGNHARCPYRALLRTHCPLRAMAAKEGSGNQAHRGVGICPLERPV
AAPQEQTDSRRLVQLLRQHSSPWQVYAFLRACLCWLVPTGLWGSRHNQRRFLRNVKKFIS
LGKHAKLSLQELTWKMKVQDCTWLHGNPGACCVPAAEHRRREEILARFLCWLMGTYVVEL
LRSFFYVTETTFQKNRLFFYRKSVWSQLQSIGIRQHFNSVHLRELSEAEVRRHREARPAL
LTSRLRFLPKPSGLRPIVNMDYIMGARTFHRDKKVQHLTSQLKTLFSVLNYERARRPSLL
GASMLGMDDIHRAWRTFVLRIRAQNPAPQLYFVKVDVTGAYDALPQDRLVEVIANVIRPQ
ESTYCVRHYAVVQRTARGHVRKTFKRHVSTFADLQPYMRQFVERLQETSSLRDAVVIEQS
SSLNEAGSSLFHLFLRLVHNHVVRIGGKSYIQCQGVPQGSILSTLLCSLCYGDMERRLFP
GIEQDGVLLRLVDDFLLVTPHLTQAQAFLRTLVKGVPEYGCRANLQKTAVNFPVEDSSLG
SAAPLQLPAHCLFPWCGLLLDTRTLEVSCDYSSYAHTSIRASLTFSQGAKPGRNMRRKLL
AVLRLKCCSLFLDLQVNGIHTVYMNVYKIFLLQAYRFHACVLQLPFNQPVRKNPSFFLRI
IADTASCCYSLLKARNAGLSLGAKGASGLFPSEAARWLCLHAFLLKLARHSGTYRCLLGV
LQAAKAHLGRQLPRGTLAALEAAADPSLTADFKTILD
NT seq 3174 nt   +upstreamnt  +downstreamnt
cccgccgccccgtccttccgccaggtgtcctgcctgaaggagctggtggccagggtggtg
cagcggctgtgcgagcgcggcgccaggaacgtgctggctttcggcttcggcctgctggac
ggagcgcgcggcgggccccccgtggccttcacgaccagcgtgcgcagctacctgcccaac
acggtaaccgagaccctgcgcggcagccgcgcctgggggctgctgctgcgccgcgtgggc
gacgacgtgctcacccacctgctggcgcgctgcgcgctctacctgctggtggccccgagc
tgcgcctaccaggtgtgcgggccgccgctctacgacctctgcgcccccgccgcctctctg
ccgctcccggcgcccgggctccccgggctccccgggctccccgggctccccgggctcggg
gcctcggcggacctcagacccacacgccaggcccagaactcgggcgcgaggcggcgccgg
gacagccccgggaccagtgtgcctctggccaagcggcccaggcgcagcgtggcctcggag
ccagagcggggcgcccacaggtcctttcccagggcccagcagcctcgtgtcagcgaagct
cccgctgtgacacctgccgaggcggcttccccagcggcctcctgggagggagggcccccc
gggactcgtccaaccaccccagcctggcatccatctccggggccccagggagcaccccat
gacccagcacaccccgagaccaaacacttcctctactgctcgggtggccgggagcggctg
cgctcctccttcctgctcagtgccctgccgcctaccctgagcggggcccgcaaactcgtg
gagaccatctttctgagctctgcgccccagaagccaggggccgcccgcaggatgcgccgc
ctgcctgcccgctactggcgaatgaggcccctgttccaggagctgcttgggaaccacgcc
cggtgcccctaccgtgcgctcctcaggacccactgcccgcttcgggccatggccgctaag
gaggggtctggcaaccaggcacacaggggagtgggcatctgtcccctggagaggccagta
gcagccccccaggagcagacggactccagacgcctggtacagctcctccgacagcacagc
agcccctggcaggtgtatgccttcctgagggcctgcctgtgctggctggtgcccactgga
ctctggggctccaggcacaaccagcgccgcttcttgaggaacgtgaagaagttcatctcc
ctgggaaagcacgctaagctctccctgcaggaactgacgtggaagatgaaggtgcaggac
tgcacctggctgcacgggaacccaggagcttgctgtgtcccggctgctgagcaccgtcgg
agagaggagatcctggccaggttcctgtgctggttgatgggcacgtatgtggttgagctg
ctcaggtcatttttttatgtcacggaaaccacgtttcaaaagaaccgactcttcttctac
cggaagagcgtctggagccagttacagagcataggaatcagacaacacttcaatagtgtg
catctccgagaactgtcagaagcagaggtcaggagacaccgggaagccagacctgctctg
ctgacctccagactccgcttcctccccaagcctagtgggctgcggccgattgtgaatatg
gactacatcatgggagccagaacattccacagagacaagaaggtccagcatctcacctca
caactgaagacactgttcagtgtcctgaactatgagcgggcccggcgccccagcctccta
ggggcctccatgctgggcatggacgacatccacagggcctggcgcacctttgtgctacgc
atacgggcccagaatccggcaccccagctgtactttgtcaaggtggacgtgacgggggca
tatgacgccctccctcaggacaggctggtagaggtgattgccaatgtgatcaggcctcag
gaaagcacatactgcgtgcgccactatgccgtggtccagaggactgcccggggacacgtc
cgcaagaccttcaaaagacacgtgtccacctttgcagacctgcagccttacatgagacag
tttgtggagcgtctgcaagagacaagctcgttgagggacgccgtggtcatcgagcagagc
tcctctctgaacgaagctggcagcagccttttccatctcttcctgcgtctggtacacaat
cacgtcgtaaggatcgggggcaagtcctacatccagtgtcagggggtccctcagggctct
atcctgtccactctactgtgcagtctgtgctacggggacatggagcgcaggttgtttcct
ggaatcgagcaggacggggtcctcctgcgcctggtggacgacttcctgctggtcacccct
cacctgacgcaagcgcaagcctttctcaggaccctggtcaaaggtgttcctgagtacggc
tgcagggccaacttgcagaagacggcggtgaactttcccgtggaggacagctccctgggc
agcgcggcccccctccagctgccagcacactgtctgttcccctggtgcggcctgctgctg
gacacccggaccctggaggtgtcctgtgactactccagctatgcccacacgtccatccgc
gcgagcctcaccttcagccagggtgccaagccagggaggaacatgcggcgcaagctgttg
gccgtcttgcggctgaagtgctgctcgttgtttctagatctgcaggtgaatggcatccac
acggtctatatgaatgtttacaagatcttcttactgcaggcttacaggttccatgcgtgt
gtgctccagcttccattcaaccagccagtgaggaagaatccctccttcttcctccgtatt
atcgcggacaccgcgtcgtgctgctactcccttctcaaagccaggaacgcagggctgtcc
ctgggggccaagggcgcctctggcctgtttccttctgaagccgcacggtggctctgcctc
cacgccttcctgctcaagctggcgcgtcacagtggcacctacaggtgtctcctgggggta
ctccaggcagccaaggcacacctgggccggcagctcccgagggggacactggctgccctg
gaggcagcagctgatcccagcctgaccgcagacttcaagaccattttggactga

DBGET integrated database retrieval system