KEGG   Vulpes vulpes (red fox): 112935545
Entry
112935545         CDS       T05911                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04024  cAMP signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04218  Cellular senescence
vvp04270  Vascular smooth muscle contraction
vvp04370  VEGF signaling pathway
vvp04371  Apelin signaling pathway
vvp04540  Gap junction
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04613  Neutrophil extracellular trap formation
vvp04620  Toll-like receptor signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04720  Long-term potentiation
vvp04722  Neurotrophin signaling pathway
vvp04730  Long-term depression
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04912  GnRH signaling pathway
vvp04915  Estrogen signaling pathway
vvp04916  Melanogenesis
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04926  Relaxin signaling pathway
vvp04929  GnRH secretion
vvp04934  Cushing syndrome
vvp04935  Growth hormone synthesis, secretion and action
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05132  Salmonella infection
vvp05135  Yersinia infection
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112935545 (MAP2K2)
   04012 ErbB signaling pathway
    112935545 (MAP2K2)
   04014 Ras signaling pathway
    112935545 (MAP2K2)
   04015 Rap1 signaling pathway
    112935545 (MAP2K2)
   04370 VEGF signaling pathway
    112935545 (MAP2K2)
   04371 Apelin signaling pathway
    112935545 (MAP2K2)
   04066 HIF-1 signaling pathway
    112935545 (MAP2K2)
   04068 FoxO signaling pathway
    112935545 (MAP2K2)
   04072 Phospholipase D signaling pathway
    112935545 (MAP2K2)
   04071 Sphingolipid signaling pathway
    112935545 (MAP2K2)
   04024 cAMP signaling pathway
    112935545 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    112935545 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    112935545 (MAP2K2)
   04150 mTOR signaling pathway
    112935545 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112935545 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    112935545 (MAP2K2)
   04218 Cellular senescence
    112935545 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112935545 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    112935545 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112935545 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    112935545 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    112935545 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    112935545 (MAP2K2)
   04660 T cell receptor signaling pathway
    112935545 (MAP2K2)
   04662 B cell receptor signaling pathway
    112935545 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    112935545 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112935545 (MAP2K2)
   04929 GnRH secretion
    112935545 (MAP2K2)
   04912 GnRH signaling pathway
    112935545 (MAP2K2)
   04915 Estrogen signaling pathway
    112935545 (MAP2K2)
   04917 Prolactin signaling pathway
    112935545 (MAP2K2)
   04921 Oxytocin signaling pathway
    112935545 (MAP2K2)
   04926 Relaxin signaling pathway
    112935545 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    112935545 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    112935545 (MAP2K2)
   04916 Melanogenesis
    112935545 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112935545 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    112935545 (MAP2K2)
   04730 Long-term depression
    112935545 (MAP2K2)
   04722 Neurotrophin signaling pathway
    112935545 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112935545 (MAP2K2)
   05206 MicroRNAs in cancer
    112935545 (MAP2K2)
   05205 Proteoglycans in cancer
    112935545 (MAP2K2)
   05230 Central carbon metabolism in cancer
    112935545 (MAP2K2)
   05231 Choline metabolism in cancer
    112935545 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112935545 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112935545 (MAP2K2)
   05225 Hepatocellular carcinoma
    112935545 (MAP2K2)
   05226 Gastric cancer
    112935545 (MAP2K2)
   05214 Glioma
    112935545 (MAP2K2)
   05216 Thyroid cancer
    112935545 (MAP2K2)
   05221 Acute myeloid leukemia
    112935545 (MAP2K2)
   05220 Chronic myeloid leukemia
    112935545 (MAP2K2)
   05218 Melanoma
    112935545 (MAP2K2)
   05211 Renal cell carcinoma
    112935545 (MAP2K2)
   05219 Bladder cancer
    112935545 (MAP2K2)
   05215 Prostate cancer
    112935545 (MAP2K2)
   05213 Endometrial cancer
    112935545 (MAP2K2)
   05224 Breast cancer
    112935545 (MAP2K2)
   05223 Non-small cell lung cancer
    112935545 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112935545 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    112935545 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112935545 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112935545 (MAP2K2)
   05135 Yersinia infection
    112935545 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112935545 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    112935545 (MAP2K2)
   05161 Hepatitis B
    112935545 (MAP2K2)
   05160 Hepatitis C
    112935545 (MAP2K2)
   05164 Influenza A
    112935545 (MAP2K2)
   05163 Human cytomegalovirus infection
    112935545 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112935545 (MAP2K2)
   05165 Human papillomavirus infection
    112935545 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112935545 (MAP2K2)
   01522 Endocrine resistance
    112935545 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112935545 (MAP2K2)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     112935545 (MAP2K2)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: STE group
  STE7 family
   112935545 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 112935545
NCBI-ProteinID: XP_025875083
UniProt: A0A3Q7TZB8
LinkDB
Position
Unknown
AA seq 502 aa
MRKGAVGKRASAHAPGTASVGLRPFPHKRAAPDWCARAAVRGGASRLPALALARGRPAIS
SLPLPDFGLPGSGCSVSLGRASSAAAAAPRPQPRSPSAPLGPVRSDASPVLPALTINPAI
AEGPSPTSEGASEANLVDLQKKLAELELDEQQKKRLEAFLTQKAKVGELKDDDFERISEL
GAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFY
SDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPS
NILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLV
ELSIGRYPIPPPDAKELEAIFGRPMVDGIEGEPHSISPRPRPPGRPISGHGTDSRPAMAI
FELLDYIVNEPPPKLPSGVFTQDFQEFVNKCLIKNPAERADLKMLMSHTFIKRSEVEEVD
FAGWLCKTLRLNQPSTPTRTAV
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcgcaaaggcgcagtggggaagcgagcgagtgcgcacgctcccggcaccgcctccgta
ggtctccgcccctttccccacaagagggcggcccccgactggtgcgcacgcgccgcggtg
aggggcggggcctcgcggctcccggcgctggctctcgcgagaggccggcccgcgatctcg
tcgctccccctccctgacttcggcctcccgggctccggctgcagcgtcagcctcggacgg
gcctcctcggctgcggcggcggctcctcggcctcagccccggagcccctcggcgcccctc
ggcccggtccgcagcgacgcctccccggtgctgccggcgctcactatcaaccccgccatc
gccgagggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctccag
aagaagctagcagagctagaacttgacgagcagcagaagaagcgactggaagccttcctc
acccagaaggccaaggtcggggaactcaaggatgacgacttcgaacggatctcagagctg
ggagctgggaacggcggggtggtcaccaaggtccagcacagaccttctggcctcatcatg
gcgagaaagctgatccacctggaaatcaagccggccatccggaaccagatcatccgcgag
ctgcaggtgctgcacgagtgtaactccccgtacatcgtgggcttctatggggccttctac
agcgacggagagatcagcatctgcatggagcatatggatggcggctctctggaccaggtg
ttgaaggaagccaagagaatccctgaggagatcctggggaaggtcagcattgcggttctc
cggggtttggcgtatctccgggagaagcaccagatcatgcaccgagacgtgaaaccatcc
aacatcctcgtcaactcccgaggggagattaagctgtgtgattttggggtgagcggccag
ctcatcgactccatggccaactccttcgtgggaactcggtcctacatgtctccagagcgg
ttgcagggcactcattactcagtgcagtcggacatctggagcatgggcctgtccctggtg
gagctgtccattggaaggtaccccatcccgccaccagatgccaaggagctagaggccatc
ttcggccggcccatggttgacgggatagaaggagagcctcacagcatctcaccacggccg
agaccccctggacgccccatcagcggtcatgggacggacagccggccagctatggccatc
ttcgagctgctggactatattgtgaacgagccgcctcccaagctgcccagtggtgtcttc
acccaggacttccaggagtttgtaaataaatgcctaataaagaacccagcagagcgagca
gatctgaagatgctcatgagccacacgttcatcaagcggtccgaggtggaagaggtggat
tttgccggctggttgtgtaaaacgctgcggctgaaccagcccagcacgcccacgcgcacc
gccgtgtga

DBGET integrated database retrieval system