KEGG   Vulpes vulpes (red fox): 112935788
Entry
112935788         CDS       T05911                                 

Gene name
SERPINE1
Definition
(RefSeq) plasminogen activator inhibitor 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04066  HIF-1 signaling pathway
vvp04115  p53 signaling pathway
vvp04218  Cellular senescence
vvp04371  Apelin signaling pathway
vvp04390  Hippo signaling pathway
vvp04610  Complement and coagulation cascades
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05142  Chagas disease
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112935788 (SERPINE1)
   04371 Apelin signaling pathway
    112935788 (SERPINE1)
   04066 HIF-1 signaling pathway
    112935788 (SERPINE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112935788 (SERPINE1)
   04218 Cellular senescence
    112935788 (SERPINE1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    112935788 (SERPINE1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112935788 (SERPINE1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112935788 (SERPINE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vvp01002]
    112935788 (SERPINE1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112935788 (SERPINE1)
   00536 Glycosaminoglycan binding proteins [BR:vvp00536]
    112935788 (SERPINE1)
Peptidases and inhibitors [BR:vvp01002]
 Peptidase inhibitors
  Family I4: serpin family
   112935788 (SERPINE1)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112935788 (SERPINE1)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   112935788 (SERPINE1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 112935788
NCBI-ProteinID: XP_025875480
UniProt: A0A3Q7V777
LinkDB
Position
Unknown
AA seq 402 aa
MQMSPVSACLALGLALVFGEASASYSYQTRAAGLATDFGVKVFQEVARASKDRNMVFSPY
GVASVLAMLQLTTAGETRRQIQEAMQFQIDEKGMAPALRQLYKELMGPWNKDEISTADAI
FVQRDLKLVHGFMPHFFRLFQTTVKQVDFSEVERARFIVNDWVKRHTKGMIGNLLGRGAV
DQLTRLMLVNALYFNGQWKTPFPESGTHHRLFHKSDGSTVSVPMMAQTNKFNYTEFSTLS
GHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILDAQLISQWKGNMTRQLRLLVLPK
FSLETEVNLRRPLENLGMTDMFRPNLADFSSLSNQEVLYVSRALQKVKIEVNESGTVASS
STAIIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgcagatgtctccagtctctgcctgccttgccctgggcctggcccttgtctttggtgaa
gcatcagcctcctattcctaccaaactcgggcagcaggactggccacagacttcggagtg
aaggtgtttcaggaggtggcacgggcctccaaggaccgcaacatggttttctctccctat
ggggtggcctcagtcctggccatgttgcagctgacaacagcaggagagactcgtcggcag
atccaagaggccatgcaattccagattgatgagaagggcatggcccctgccctccgccaa
ctatataaggaactcatggggccgtggaacaaggatgagatcagcactgccgatgccatc
ttcgtccagcgggatctgaagctggttcacggcttcatgccccacttcttcaggctgttc
cagaccacagtcaaacaggtggacttttcagaggtggagagagccaggttcatcgtcaac
gactgggtgaagagacacacaaaaggcatgattggaaacttactgggcagaggggccgtg
gaccagctgacgcgtctgatgctggtaaatgccctctacttcaacggccagtggaagacg
cccttcccagagtcaggcacccaccaccgcctcttccacaaatctgacggtagcactgtc
tctgtgcccatgatggctcagaccaacaagttcaactacaccgagttttctaccctcagt
ggccattactatgacatcctggaattgccctaccatggggacactctcagcatgttcatc
gctgctccctatgaaaaagaggtgcctctctctgccctcaccaacatcctggatgcccag
ctcatcagccagtggaaagggaatatgaccaggcagctccgcctcctggttctgcctaag
ttctccctggagaccgaagtcaacctgcggaggcccctggagaatctgggcatgaccgac
atgtttaggccaaacctggcggacttctcaagtctttcaaatcaagaggtgctgtatgtg
tcgcgggcactgcaaaaagtaaagattgaagtgaatgagagtggcacagtggcgtcctcc
tctactgccattatcgtctcagcccgaatggccccggaggagatcatcatggacagaccc
ttcctttttgtggtgcggcacaaccccacaggaacagtccttttcatgggccaagtgatg
gaaccctga

DBGET integrated database retrieval system