KEGG   Vulpes vulpes (red fox): 112935856
Entry
112935856         CDS       T05911                                 

Gene name
GTSE1
Definition
(RefSeq) G2 and S phase-expressed protein 1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112935856 (GTSE1)
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 112935856
NCBI-ProteinID: XP_025875589
UniProt: A0A3Q7TDZ1
LinkDB
Position
Unknown
AA seq 734 aa
MDVPKEDDILFLADEKFDFDLSLSSSSANEDEEVFFGPVGHKERCVAASLELNHQIPKEP
LLPASESHFTWSPLTGEKFVEVYKEAHLLALQIESKSKNKAAQEVTAEDLWSQGVERFIQ
ESKLKIDLFEKENEMKKSPKSLKRETYYLSDSPLGGLPLSGNQTPSGMALPSAPVQTSLA
RTQGPPRSPCPSLPVKPRTAHPPHQAGTQKRVISKLVPPRALSFRGKNIHVAPEQAMKRI
PASPSGMKILNEKESHRDVPPDKSSAAQELAGMPAGGSHLVQGKRSLPVPNKLGLKKALL
KRPGCAGGLSRKSSSSGSVLAVISNECASPAAGRARSSEPASVPAGSPPLPSNPSQSGRA
GLTTPRQPLQTGPAGASCRPSKWATAAGGTAEPAKAPSPAADSTARTPEQRGPGPSSCSS
SSWSQPSQGNTARSTRRRDSYLQCRTWAMPTPTSQFKIPRFSTGKPPDGTTPKSHRAQRP
QSCTSAGRVVVHSTPARRSSMVASQSLAGGTRTPVSTKYVSALPTPASRRLSGLPPVTPK
TMPRALALPPCMSACQLSSEPQKKSSVRAALTRERHSEAASEHEDSSPDKPSSPLLAVPQ
ALNFSPEKSDFTFSKSISSEVVLDAAPPPGDRPASETLLVDINLDQLAITPKAESTALVD
HPLIDFGNTPEANAAPGSESRPLIDLLINTPDMNKNTVSKPPHEVAQLIDLASPLIQLSP
EADKENVDSPLLKF
NT seq 2205 nt   +upstreamnt  +downstreamnt
atggatgttcccaaggaggacgacattcttttcttggctgatgaaaaatttgacttcgat
ctttcattgtcttcttcaagtgcaaatgaagatgaggaagtcttctttggacccgttggg
cataaagaaagatgcgttgctgccagcttggaattaaatcatcagattcccaaagaacct
cttttgccagcttcggaaagtcacttcacctggagtcctctcactggggagaaatttgtg
gaagtgtataaagaagctcacttattggccttacagatagaaagcaaaagcaaaaacaaa
gcagcccaagaggtcacagctgaagacctttggagccagggtgtggaaagatttatacag
gaatcaaaattaaaaatagacctgtttgagaaagaaaatgaaatgaagaaaagccccaag
tcgcttaagagggagacgtattacctgtcagacagccccttggggggactgccactttca
ggaaaccagaccccctcaggcatggccctgccaagcgctcccgttcagactagcctcgcc
cggacacagggacccccacggtcaccctgcccttctctgcctgtgaaaccaagaactgct
caccctccacaccaggcggggactcagaaaagggtcatcagcaaattggtgccaccccga
gctttgtcttttagagggaaaaacattcatgtggccccagagcaggctatgaaaaggata
ccagctagtccttcaggtatgaaaatcctaaatgaaaaggaatcccacagggacgtgccc
ccggacaaatccagtgctgcccaagagcttgccggcatgccagctggtggaagccacttg
gtccaaggcaagcgatcgctccccgttccaaacaagttgggcctgaagaaagccctgttg
aaacgacctggttgtgctggcggtctttcgagaaagtcctcttcctcagggtccgttttg
gctgtgatttccaatgagtgtgcttctccggcagccggcagagctaggtcaagtgaacct
gcaagtgtccctgcgggtagtcccccactgccatccaaccccagccagtcaggcagagcg
ggactcaccacgcctcggcagcctctgcagacaggccctgcgggtgcatcctgcaggccg
agcaagtgggccacggcggctgggggaacggcggagccagccaaggcacccagcccagcg
gctgacagcacagccaggacgccggaacagagaggcccggggccgagctcctgctccagc
tccagctggtctcagccttctcaggggaacacagccaggagtacgagaaggcgtgactcc
taccttcagtgcaggacgtgggccatgcccacgccgacaagtcaatttaagataccgagg
ttttctactggtaagcccccagatggcacaacgcccaagtcccatcgggcacagaggccg
cagtcctgcacgtcggcgggaagggtagttgtgcatagcactcctgctagacgctcatca
atggtggcctcacaaagccttgcaggcggtacgaggacccccgtgagtacgaagtacgtg
tcagccctgcccacacctgccagccgtcggctctctggccttccgccggtgacccccaaa
accatgcccagagctctggctttgcccccgtgtatgtctgcttgtcagctttcttctgag
ccccagaaaaaatcttccgtgagagctgcactaacgagggagcgccacagtgaggctgcc
tctgagcatgaggactcatcacctgataagccttcctcccctctgttggctgtgccacag
gcacttaacttttctccagaaaagagtgactttactttttcaaaaagtatcagctcagaa
gtagtgctggatgcggccccgccacctggagataggcctgctagtgagactcttctcgtg
gacatcaacctggatcaacttgccatcactccgaaagctgaaagcacagctctcgtcgac
caccctctcattgactttggcaatactccagaagcaaatgcagctccaggatctgagagt
agacctctgatcgacctgctgataaacactccagacatgaacaaaaacacggtgtccaag
cctccccatgaggtggcacagctgatagacttggcttctcctctgatccagctgagtccc
gaggctgacaaggaaaacgtggattctccacttctcaagttctga

DBGET integrated database retrieval system