KEGG   Vibrio vulnificus CMCP6: VV1_0577Help
Entry
VV1_0577          CDS       T00108                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00471  D-Glutamine and D-glutamate metabolism
vvu00550  Peptidoglycan biosynthesis
vvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    VV1_0577 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VV1_0577 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vvu01011]
    VV1_0577 (murC)
Enzymes [BR:vvu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     VV1_0577 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:vvu01011]
 Precursor biosynthesis
  Amino acid ligase
   VV1_0577 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: AAO09093
UniProt: Q8DEL1
LinkDB All DBs
Position
I:complement(590497..591957)
Genome map
AA seq 486 aa AA seqDB search
MTIQHKQDLAQIRAMVPEMRRVKSIHFIGIGGAGMSGIAEVLLNEGYQITGSDIAENAVT
ERLAQKGAKVYIGHQATNVAEASVVVVSTAINEANPEVKAAREARIPVVRRAEMLAELMR
FRHGIAVAGTHGKTTTTALVTQIYSEAGLDPTFVNGGLVKSAGTNARLGSSRILIAEADE
SDASFLHLQPMVCIVTNIEADHMDTYGGDFETLKQTFIDFLHNLPFYGQAIVCIDDPVIR
ELIPRISRQVITYGFSEDADVRIENYRQEGQQGKFTVVRKDCEALDITLNIPGRHNALNA
AAAIAVATEDEIGDDAILAAMVGTQGTGRRFEHLGEFETGNGNVMLVDDYGHHPTEVDVT
IQAARNGWQEKRLVMIFQPHRYSRTRDLYDDFANVLEQVDVLVMLDVYAAGEKAIAGADS
RSLCRTIRSRGKIDPIFVADTQQLPEVLANILQEGDLLLAQGAGDIGKVARQLAALELNI
SNMKAK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactattcaacacaagcaagatcttgcacagattcgcgctatggttccagagatgcgc
cgagtgaaatccatccacttcattggtattggtggcgcaggtatgagcggcattgccgaa
gtgttgctcaatgaagggtatcaaatcaccggctctgatattgcggaaaatgccgttact
gagcgcttggctcaaaaaggcgcgaaagtgtatatcggccaccaagcgacgaatgttgca
gaggcgagtgttgttgttgtctcaacagcgatcaatgaagcgaacccagaagttaaagcg
gcgcgtgaagctcgcattccggttgttcgccgtgcagaaatgctggcggaactgatgcgt
tttcgtcatggtatcgccgtcgctggtacgcatggtaaaaccaccacgacagcattggtg
acgcaaatttattcagaagcgggactggatccaacgttcgtgaatggtggtctggtaaaa
agtgcaggtaccaatgcgcgtttaggttctagccgcattttgattgctgaagccgatgaa
agtgatgcgtcgttcttacatttgcaaccgatggtgtgtattgtcacaaacattgaagct
gaccatatggatacctatggcggtgacttcgaaacactgaagcaaaccttcatcgacttc
ttacacaatttgccattttatggtcaggcgattgtttgtattgatgatccggtgattcgc
gagctgatcccgcgcatcagtcgtcaagtcattacttacggcttctcggaagatgccgat
gttcgcattgaaaattaccgtcaagaaggccagcaaggaaaattcaccgtggtccgcaaa
gattgcgaagcgctggatattaccctgaatattcctggccgccacaatgcattgaatgcc
gctgcggccattgctgttgcaacggaagatgaaattggcgatgacgcgatccttgctgcc
atggttggtacccaaggtactggtcgccgcttcgagcatctgggtgagtttgaaacaggc
aacggaaacgtaatgctggttgatgactatggtcatcacccaaccgaagtggatgtgacc
atccaagctgcacgaaacggttggcaagagaagcgtctcgtgatgattttccaaccccac
cgttacagccgtacccgagatctctacgatgatttcgcgaacgtgcttgagcaggttgat
gtgttggtcatgttagatgtgtacgcggcgggtgaaaaagcgattgctggagcggacagt
cgttcattgtgccgcacgattcgcagtcgtggaaaaatcgaccctatttttgttgcagat
acccaacaactgccagaggtattggcgaacattttacaagaaggcgatctgttattagca
caaggtgcgggggatattggtaaagtcgcccgacaattggcagcacttgagctaaatatc
agtaatatgaaagcaaaatag

DBGET integrated database retrieval system