KEGG   Vibrio vulnificus CMCP6: VV1_0584Help
Entry
VV1_0584          CDS       T00108                                 

Definition
(GenBank) Cell division protein ftsI (Peptidoglycan synthetase)
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00550  Peptidoglycan biosynthesis
vvu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VV1_0584
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    VV1_0584
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vvu01011]
    VV1_0584
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvu03036]
    VV1_0584
Enzymes [BR:vvu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VV1_0584
Peptidoglycan biosynthesis and degradation proteins [BR:vvu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   VV1_0584
Chromosome and associated proteins [BR:vvu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    VV1_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AAO09100
UniProt: A0A3Q0L278
LinkDB All DBs
Position
I:complement(599575..601305)
Genome map
AA seq 576 aa AA seqDB search
MMGKKSKTTVKPKESEQGTSLLIRWRFHLVLGFVFLAFAALVVRLAFIQVIEPDNLIREG
DLRSIRVKALPSARGIISDRNGEPLAVSVPVEAVWADPVTIFKEKALDNKQRWYALADVL
GLQREELIERIERNESRRFIYLQRQVSPAMANYIRELKIPGVGLKSESRRYYPAGEVSAH
LVGVTGIDGHGLEGVERSYDNWLTGEAGKQTIRKDRYGRVVENIAYEDRQEGKSLELTID
QRLQAIAYRAIKQAVADHRATSGSAVMLDVKTGAVLAMVNAPSYNPNNRSDWQSYKMRNR
IITDSLEPGSTVKPFVILAALENGVATKDTVIDTGNGILQVGGSRVRDTSKVGKADLTEI
LKKSSNIGVTKLSMEMPVEAILGMYNSVGLGEPSGLNLVGEVTGIFPTRSRWSPIERATL
SFGYGLSITPIQLAHAYATLGNEGMYEPIHIIKSNDRDMAKQVVSKQHAREVLNMLETVT
QKGGSARRAAVPGYRVGAKTGTSRKATAGGYSDEYITYTAGIAPVSDPRIALVVVVNEPQ
GDDYYGGSVASPVFSEIMKGALQILNVAPDENAFQN
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtaaaaagagcaaaaccaccgtcaaacccaaagagagtgagcaagggacatct
ttgcttatccgctggcgtttccatttagtcctaggatttgttttcctcgcgtttgctgcg
cttgttgttcgtcttgcatttattcaagtcattgagcctgacaaccttattcgtgaaggg
gatctgcgttctatccgtgtgaaagcccttccgtccgcgcgaggtatcatctccgatcgc
aatggtgaacctttagcggtcagtgttcccgttgaagctgtctgggccgatccggtgacg
attttcaaagaaaaggcgctggataacaaacagcgttggtatgcgttagccgatgtgttg
gggctgcagcgtgaagaattgattgaacgtatcgagcgcaatgaaagccgccgcttcatc
tacttgcagcgccaagtgagccccgcgatggcgaactacatacgcgagcttaaaattcca
ggcgtggggctgaaatcagaatcgcgccgctattatcccgctggtgaagtgagtgctcat
ttagtgggtgtaacgggtatcgatggtcacggccttgaaggggtggaacgcagttacgat
aactggttgactggtgaagcgggtaaacagacgattcgtaaagaccgttatggccgagtg
gtggaaaacattgcctatgaagacaggcaagaaggcaagtcacttgaactcaccattgat
cagcgtctccaagccattgcttatcgcgccatcaaacaggcggtggccgatcaccgtgcg
acttctggttcggcagtgatgttggatgtaaaaaccggcgccgtgttggcgatggtcaac
gcgccttcttacaacccaaacaatcgcagtgattggcaaagctacaagatgcgtaaccgc
atcatcaccgattcgttggagcctggctccacggtgaagccttttgtgattcttgccgcg
ctggaaaacggcgttgccaccaaagacacggtgatcgacacgggcaacggcattctccaa
gtcggtggcagtcgagtacgagatacgagtaaggtcggtaaagcggacctgaccgaaatc
ctcaaaaaatccagtaatatcggcgtgacaaaactgtcgatggaaatgcccgtggaagcg
attctcggcatgtataactcggttgggcttggagagccttctgggttaaatcttgttggc
gaagtgaccggtattttccctactcgttcgcgttggtctccgattgagagagcgacgctg
tcgtttgggtacggtctgtctatcactccgattcaattggctcatgcctacgcaaccttg
ggcaatgaaggtatgtacgagccgatccacatcatcaaaagcaacgaccgtgatatggcg
aagcaagtggtgtccaaacaacacgctcgtgaagtgctcaatatgcttgaaaccgtgacg
caaaaaggcggctcagccagacgagcggccgttccgggttaccgggttggggcgaaaacg
gggacatcacgtaaagcaacggctggtgggtatagcgatgagtacatcacctacacggcg
gggattgcgccagttagcgatccgagaattgctttggtcgtggtggtcaatgaaccacaa
ggggatgattactatggtggttccgttgcttcccctgttttttcagaaattatgaaaggt
gcgctgcaaattttgaatgtggcacccgatgaaaatgcattccagaactag

DBGET integrated database retrieval system