KEGG   Vibrio vulnificus CMCP6: VV1_1572
Entry
VV1_1572          CDS       T00108                                 

Definition
(GenBank) GGDEF domain protein
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VV1_1572
Enzymes [BR:vvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VV1_1572
SSDB
Motif
Pfam: GGDEF HAMP DUF1449
Other DBs
NCBI-ProteinID: AAO09996
UniProt: A0A3Q0L3T9
LinkDB
Position
I:1542013..1543272
AA seq 419 aa
MNNLPRHSLANRLLRFVSICAIVYLVLLLALMIPFGFKNAKQAHTELEQKLVLSLSNSAA
IALYVNNHEIAEEVIDSLLLHDEINAVRLESLEGVTFDKIKPGQFEKDMWLHANQYPLLS
PVDAKPLGILYVHDNHLVIQRKTLDKVLYQILFVLLQFLMTFVVIALVVKRIIGKPLRAL
SIAVSRATPGQVKTVEVDDINRNNEIGLVASSINTFIENSHQALIREKELRSQIERWEIY
YRGMAEQDTLTGLKNRLGCEKHFSHMKHSEAYLSLLLIDLDGFKAVNDSHGHAVGDAVLS
TIANRYLHLTQEHFNQSVVGRIGGDEFVIYLPHRDGPEKMEAFLLAFAEQLIESSNTPIE
VKQLQVHVGCSIGIATATAAKADMEKLLLQADNAMYLAKQDGKNTARFFRRPVSQSVGN
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgaataacttgccgagacattcattagcgaatcgcctgctgagatttgtttcgatatgc
gcgattgtctatctagtgcttttgctggcgctgatgattccgtttggctttaaaaatgcg
aagcaagcgcatacggagttagaacaaaaattggtgttgtctctctctaactcggcggcc
atcgcgttgtatgtcaataaccatgagattgccgaagaggtgattgactctttgctgctg
catgatgaaatcaatgctgtgcgtcttgaaagtttagagggcgtgacgtttgacaaaatc
aaaccggggcagtttgaaaaagacatgtggctgcacgcgaatcaataccctttactctca
ccagtggatgccaaaccattggggattctgtatgtgcacgacaatcatttggtgattcaa
cgtaaaaccctcgacaaagtgctttaccagattttgtttgttttgctgcagtttttgatg
acgtttgtggtcattgcgttggtggtaaaacgcatcatcggtaagccattgagggcgcta
tcgattgcggtgtcgcgtgccactccaggacaggtgaaaaccgttgaagtggatgatatc
aatcgcaacaacgaaatcggtttggtggccagtagcatcaacacctttattgaaaactcg
catcaggcactgatccgagagaaagagctacgctctcagattgaacgttgggaaatctac
taccgtggtatggcggagcaagacaccttaactggtctcaaaaaccgtttgggctgtgaa
aaacacttttcacacatgaaacacagtgaggcttatttatcactgttactcattgattta
gatggttttaaagcagtcaatgacagccatgggcatgcagtgggtgatgccgtgttatcc
accatcgcgaatcgttaccttcatctgacccaagagcattttaatcaaagtgtcgttggg
cggattggtggggatgagtttgtcatttacttgccacatcgtgatgggccagaaaaaatg
gaagcctttttgttggcgtttgctgagcagttaattgagtcgagcaatacgccgattgaa
gtgaaacaactgcaagtacatgtcggttgcagtatcggcattgcgacggcaacggccgca
aaagccgatatggagaagttgctgcttcaagctgataatgcaatgtaccttgccaaacag
gatggaaaaaacactgcgcgtttttttcgccgaccggttagccagtcggtaggtaactga

DBGET integrated database retrieval system