KEGG   Vibrio vulnificus CMCP6: VV1_2824Help
Entry
VV1_2824          CDS       T00108                                 

Definition
(GenBank) Glutamate decarboxylase, eukaryotic type
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00250  Alanine, aspartate and glutamate metabolism
vvu00410  beta-Alanine metabolism
vvu00430  Taurine and hypotaurine metabolism
vvu00650  Butanoate metabolism
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01120  Microbial metabolism in diverse environments
vvu02024  Quorum sensing
Module
vvu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VV1_2824
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VV1_2824
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VV1_2824
   00430 Taurine and hypotaurine metabolism
    VV1_2824
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VV1_2824
Enzymes [BR:vvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VV1_2824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS SHMT Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AAO11161
LinkDB All DBs
Position
I:2886175..2887836
Genome map
AA seq 553 aa AA seqDB search
MAMEQKTADVSFDSLLKIFTIPEGPDSTLTQIEAKLSQNLNKFLGEHIVAEEKPLREIEK
DFSSAQIPERPSFVSDHTEHLLNTLVSHSVHTSSPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYSQDEAFYSHWMHSAEHSLGAFCSGGTIANITA
LWVARNNALRAQGDFKGVEKEGLFRAMKHYGYEGLAVLVSERGHYSLKKAADVLGIGQAG
LVAIKTDENNRVCPDALEAKIKELQAQNIKPFAVIGVAGTTETGSVDPLAEMAKICQKYG
CHFHVDAAWGGATLMSNKYRSLLDGVELADSVTIDAHKQLYIPMGAGMVLFKDPNAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYASMHIISRPGYELLINQSIEKAKYFADL
IKQQDDFELISEPELCLLTYRYIPARVKQALAAANAKQQLELNELLNELTKFTQKRQRET
GRSFVSRTRLNPAHWSRMNTIVFRVVLANPLTSFDILASVLEEQRNIIVHQAPNLLAKIN
KLADGILTSTQSS
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggaacaaaaaaccgctgatgtcagctttgatagcctactgaagatcttcact
atcccagagggtcctgattcaacactgactcaaatcgaagcaaagctctcacaaaactta
aacaaattcctcggtgaacacatcgtggcagaagaaaagcctttacgtgaaatcgagaaa
gacttttcttctgctcagatcccagagcgaccgtcctttgtctcagaccatactgagcac
ctactcaatactttggtatcgcactctgtgcatacgtcgtcacccagttttatcggtcat
atgacttctgcgctcccatactttttgatgcctctatcaaaaatcatgattgcgctaaac
caaaacttggtaaaaatcgagacatcgaaagcctttacgccgctcgagcgtcaggtttta
ggtatgttacatcgcttaatttattcgcaagatgaagcgttttactctcattggatgcac
agtgcagagcactccttaggggcgttttgttcaggtggaaccatcgccaacatcacggcc
ctttgggtagcacgtaacaatgcgttacgtgcgcaaggcgactttaaaggtgttgagaaa
gaagggcttttccgtgcgatgaaacactatggctacgaagggcttgcggtgttggtttct
gagcgtggtcattactcgctaaaaaaagccgcggatgttctaggtattggccaagcaggc
ttggtggccatcaaaaccgacgaaaacaatcgtgtttgtcccgatgctctcgaagcgaaa
attaaagagttgcaagcgcaaaacatcaaaccatttgccgtcatcggagtagcagggaca
acggagacgggtagcgtcgatccattagcagaaatggcaaaaatttgccaaaaatatggc
tgtcatttccatgttgacgcggcttggggcggcgcaacattaatgtcaaacaagtatcgc
tccctactcgatggtgttgaacttgccgactctgtgacgattgacgcgcataagcaactg
tatatcccaatgggcgcaggaatggtgctattcaaagatcctaacgcaatgaaatcgatc
gagcatcacgctcaatatattctgcggaaaggttctaaagacttgggtagtcacacacta
gaaggttctcgttcaggcatggcaatgttggtttatgccagcatgcatatcatcagccgc
cctggctacgagctgctcatcaatcaaagtattgaaaaagcaaaatactttgctgatttg
atcaaacaacaggatgattttgagctgatctccgaacctgagctttgtctgctcacctat
cgctatatcccagctcgagtgaaacaagccttagctgcagccaacgcaaaacaacaatta
gagctcaacgagctactgaatgaactcaccaagttcactcaaaaacgccaacgtgagact
ggtcgctcatttgtatcgcgcacacgccttaatcccgcacattggtctcgcatgaacacc
attgttttccgcgttgtgttggcaaacccactgaccagctttgacatccttgcatccgtg
ttggaagaacaaagaaatatcattgttcatcaagcgccaaatctgttggcaaaaatcaac
aagttagcagatggcattctaaccagcactcagtcgagctga

DBGET integrated database retrieval system