KEGG   Vibrio vulnificus CMCP6: VV1_3107Help
Entry
VV1_3107          CDS       T00108                                 

Definition
(GenBank) Superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vvu  Vibrio vulnificus CMCP6
Brite
Enzymes [BR:vvu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VV1_3107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AAO11430
LinkDB All DBs
Position
I:3174831..3175430
Genome map
AA seq 199 aa AA seqDB search
MENRAMAFELPALPYAKDALEPHISAETLEFHHGKHHNTYVVKLNGLIPGTEFEGKTLEE
IIKTSTGGIFNNAAQVWNHTFYWHCLAPNAGGEPTGAVAEAINAAFGSFEEFKAKFTDSA
INNFGSSWTWLVKKADGSLAIVNTSNAATPITEEGVTPLLTVDLWEHAYYIDYRNLRPDY
MNGFWALVNWDFVAENLAK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggagaatcgagcaatggcatttgaactaccagctcttccttacgcaaaagacgcgctt
gagccacacatctctgcagaaactcttgagttccaccacggcaaacaccacaacacttac
gttgtgaaactgaacggcctaattcctggtactgaattcgaaggtaaaactctagaagag
atcatcaagacttctactggcggtatcttcaacaacgcagcgcaagtatggaaccacact
ttctactggcactgtcttgctccaaatgcaggcggcgagccaacaggtgcagttgcagaa
gcgatcaacgcagcattcggttcattcgaagagttcaaagcaaaattcacggattcagca
atcaacaactttggttcatcttggacttggttggtgaagaaagctgacggctctctagca
atcgttaatacttcaaatgcggcaacaccaatcactgaagaaggcgtaactccactactg
actgtagacctatgggaacacgcttactacatcgattaccgcaacctacgtccagactac
atgaacggtttctgggcactggttaactgggatttcgttgcagagaacctagcgaaataa

DBGET integrated database retrieval system