KEGG   Vibrio vulnificus CMCP6: VV1_3174Help
Entry
VV1_3174          CDS       T00108                                 

Definition
(GenBank) Aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00220  Arginine biosynthesis
vvu00250  Alanine, aspartate and glutamate metabolism
vvu00290  Valine, leucine and isoleucine biosynthesis
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01130  Biosynthesis of antibiotics
vvu01210  2-Oxocarboxylic acid metabolism
vvu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VV1_3174
   00290 Valine, leucine and isoleucine biosynthesis
    VV1_3174
   00220 Arginine biosynthesis
    VV1_3174
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vvu01007]
    VV1_3174
Enzymes [BR:vvu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VV1_3174
    2.6.1.66  valine---pyruvate transaminase
     VV1_3174
Amino acid related enzymes [BR:vvu01007]
 Aminotransferase (transaminase)
  Class I
   VV1_3174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AAO11490
LinkDB All DBs
Position
I:3248818..3250032
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGD
EMLVPAPDYPLWTAAVALSGGKAVHYLCDEQADWYPDLDDMRKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHKLMIFADEIYDKVLYDGAVHTSVATLTDDVLVMTFNGLSK
AYRVCGFRGGWMFMTGPKHLAQGYVNGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGVSCVKPKGAMYLFPKIDTKKYSIKDDQKMVFDFLVQEK
VLLVQGSGFNWPKPDHFRIVTLPHIEDLETAIGRFERFLHGYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgacaatgtctgctatgacatcaggggtcct
gtactcaaacatgctaagcgcatggaagaagaagggcataaaatccttaagctaaatatt
ggaaaccccgccccatttggctttgacgcccctgatgaaattctggtcgatgtgattcgt
aacttgcctacgtcgcaaggttactgcgattcaaaaggcatctactcagcacgtaaagcc
gtggtacagcactaccaacgcaaaggcattcgttctctcgatgtggaagatgtctacgtg
ggcaatggcgtctctgagctgatcgtgatggccatgcaagcactgcttaacaacggtgac
gaaatgctggttccagcaccagactacccattatggaccgctgccgtggcactttcgggt
ggtaaagcggtgcattacctctgtgatgagcaagcagactggtaccctgatctggatgat
atgcgcaaaaaaatcacgcctaagactcgtggtattgtactcatcaacccaaataaccca
acgggtgccgtctacagccgcgattttctactggaagtgatcgaaatcgcgcgtcaacac
aagctgatgattttcgccgatgaaatctacgacaaggtgttgtacgacggagcggttcac
acctcagtcgcgaccttaactgacgatgtgctggtgatgacgtttaacggcctatcaaaa
gcctatcgcgtatgtggtttccgtggtggttggatgtttatgaccggaccaaaacattta
gcgcaaggctatgttaacggtttggacatgctggcttcgatgcgcctgtgcgccaacgtg
ccaatgcaacacgcgattcaaactgccttggggggctatcagagcatcaatgaattgatc
ttacctggcggtcgtttattggagcaacgtgatcgcgcatgggagttgatcaaccaaatc
cctggcgtttcatgtgtgaaaccaaaaggcgcaatgtatctgttccctaagattgatacg
aaaaaatacagcatcaaagatgaccaaaagatggtttttgattttctcgttcaagaaaaa
gtgttgttagtgcagggttctggattcaactggccaaaaccagaccacttccgcattgtc
actctaccgcatatcgaagatctcgaaaccgccattggccgctttgaacgtttcttacat
ggctatagccagtag

DBGET integrated database retrieval system