KEGG   Vibrio vulnificus CMCP6: VV2_0280Help
Entry
VV2_0280          CDS       T00108                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00473  D-Alanine metabolism
vvu00550  Peptidoglycan biosynthesis
vvu01100  Metabolic pathways
vvu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VV2_0280
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VV2_0280
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VV2_0280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vvu01011]
    VV2_0280
Enzymes [BR:vvu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VV2_0280
Peptidoglycan biosynthesis and degradation proteins [BR:vvu01011]
 Precursor biosynthesis
  Amino acid ligase
   VV2_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 TTL
Motif
Other DBs
NCBI-ProteinID: AAO07245
UniProt: Q8D781
LinkDB All DBs
Position
II:311657..312652
Genome map
AA seq 331 aa AA seqDB search
MMRNVLLLCGGGSSEHEISLLSSEYLQQQLGLIENVNVLKVEIKNEGWFDQKERLVYLDI
HTKSVKSDEFNESIHIDFIVPCIHGFPGETGDIQSLFELAGIPYLGCGPEASSNSFNKIT
SKLWYDAIGIPNTPYLFLTENNEESHQLSREAFDKWGKLFVKAARQGSSVGCYSVTKIEQ
LSDAIDKAFGFSHQVLVEKAVKPRELEVSAYEMNGQLHISKPGEIIAPDGAFYSYDEKYS
AGSHSITEVEAKNLTEQQLATIQLCSEKVFRQMNLRHLSRIDFFLTSEGEIYLNEVNTFP
GMTKISMFPKMLQHNGHKFHEFLADCIERSL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaatgttctacttttatgcggcggtggttcttcagaacacgaaatttcgctg
ctttcttctgaataccttcagcaacaacttggcttaattgagaatgtaaatgtcctaaag
gttgagattaagaacgaaggttggtttgaccaaaaagagagacttgtgtatctcgatatc
catacgaaaagcgtgaaaagcgatgagtttaatgaatcgatacacatcgatttcattgta
ccttgtattcatggctttccgggtgaaacaggggatattcaatcactttttgagcttgca
ggtattccttatctgggctgtggtcctgaagctagcagtaacagcttcaataaaatcacg
tcgaaactatggtatgacgcgattggcattcctaacacaccgtatcttttcctaacagag
aacaacgaagagtctcaccagctcagtagagaggcattcgataaatggggcaaactgttt
gtcaaagcggcgagacaggggtcatctgttggttgttacagtgtaaccaaaatagagcag
ctttctgatgccattgataaagcgttcggattctctcatcaggtattggttgaaaaggca
gtaaaaccaagagaattagaagtttccgcatatgagatgaacggtcaacttcatatttca
aagccaggtgaaattattgctccagacggcgctttttactcctacgatgagaaatacagt
gcgggtagccattcaatcacagaagtggaagcgaaaaacttaaccgaacagcagctagcg
acgattcaactgtgcagcgagaaagtctttcgtcagatgaaccttcgtcatttgtctcga
atcgatttcttcttaaccagtgaaggagagatctaccttaatgaagtgaatacctttcct
ggaatgacaaaaatttccatgttccccaaaatgctccaacacaatggacataagtttcat
gaattcctagcggactgcattgaacgctcactttaa

DBGET integrated database retrieval system