KEGG   Vibrio vulnificus YJ016: VV1114Help
Entry
VV1114            CDS       T00150                                 

Definition
(GenBank) putative aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00220  Arginine biosynthesis
vvy00250  Alanine, aspartate and glutamate metabolism
vvy00290  Valine, leucine and isoleucine biosynthesis
vvy01100  Metabolic pathways
vvy01110  Biosynthesis of secondary metabolites
vvy01130  Biosynthesis of antibiotics
vvy01210  2-Oxocarboxylic acid metabolism
vvy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VV1114
   00290 Valine, leucine and isoleucine biosynthesis
    VV1114
   00220 Arginine biosynthesis
    VV1114
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vvy01007]
    VV1114
Enzymes [BR:vvy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VV1114
    2.6.1.66  valine---pyruvate transaminase
     VV1114
Amino acid related enzymes [BR:vvy01007]
 Aminotransferase (transaminase)
  Class I
   VV1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAC93878
UniProt: Q7MMF8
LinkDB All DBs
Position
I:complement(1121122..1122336)
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGD
EMLVPAPDYPLWTAAVALSGGKAVHYLCDEQADWYPDLDDMRKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHKLMIFADEIYDKVLYDGAVHTSVATLTDDVLVMTFNGLSK
AYRVCGFRGGWMFMTGPKHLAQGYVNGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGVSCVKPKGAMYLFPKIDTKKYSIKDDQKMVFDFLVQEK
VLLVQGSGFNWPKPDHFRIVTLPHIEDLETAIGRFERFLHGYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgacaatgtctgctatgacatcaggggtcct
gtactcaaacatgctaagcgcatggaagaagaagggcataaaatccttaagctaaatatt
ggaaaccccgccccatttggctttgacgcccctgatgaaattctggtcgatgtgattcgt
aacttgcctacgtcgcaaggttactgcgattcaaaaggcatctactcagcacgtaaagcc
gtggtacagcactaccaacgcaaagggattcgttctctcgatgtggaagatgtttacgtg
ggcaatggcgtctctgagctgatcgtgatggccatgcaagcactgcttaacaacggtgac
gaaatgctggttccagcaccagactacccattatggaccgccgccgtggcactttcaggc
ggcaaagcggtgcattacctctgtgatgagcaagcagactggtaccctgatctggatgat
atgcgcaaaaaaatcacgcctaagactcgtggtattgtactcatcaacccaaataacccg
acgggtgccgtctacagccgcgattttctactggaagtgatcgaaatcgcgcgtcaacac
aagctgatgattttcgccgatgaaatctacgacaaggtgttgtacgacggagcggttcac
acctcagtcgcgaccttaactgacgatgtgctggtgatgacgtttaacggcctatcaaaa
gcctatcgcgtatgtggtttccgtggtggttggatgtttatgaccggaccaaaacattta
gcgcaaggctatgttaacggtttggacatgctggcttcgatgcgcctgtgtgccaacgtg
ccaatgcaacacgcgattcaaactgccttggggggctatcagagcatcaatgaattgatc
ttacctggcggtcgtttattggagcaacgtgatcgcgcatgggagttgatcaaccaaata
cctggcgtttcatgtgtgaaaccaaaaggcgcaatgtatctgttccctaagattgatacg
aaaaaatacagcatcaaagatgaccaaaagatggtttttgattttctcgttcaagaaaaa
gtgttgttagtgcagggttctggattcaactggccaaaaccagaccacttccgcattgtt
actctaccgcacatcgaagatctcgaaaccgccattggccgctttgaacgtttcttacat
ggctatagccagtag

DBGET integrated database retrieval system