KEGG   Vibrio vulnificus YJ016: VV1178
Entry
VV1178            CDS       T00150                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vvy  Vibrio vulnificus YJ016
Brite
Enzymes [BR:vvy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VV1178
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: BAC93942
UniProt: Q7MM95
LinkDB
Position
I:complement(1195372..1195971)
AA seq 199 aa
MENRAMAFELPALPYAKDALEPHISAETLEFHHGKHHNTYVVKLNGLIPGTEFEGKTLEE
IIKTSTGGIFNNAAQVWNHTFYWHCLAPNAGGEPTGAVAEAINAAFGSFEEFKAKFTDSA
INNFGSSWTWLVKKADGSLAIVNTSNAATPITEEGVTPLLTVDLWEHAYYIDYRNLRPDY
MNGFWALVNWDFVAENLAK
NT seq 600 nt   +upstreamnt  +downstreamnt
atggagaatcgagcaatggcatttgaactaccagctcttccttacgcaaaagacgcgctt
gagccacacatctctgcagaaactcttgagttccaccacggcaaacaccacaacacttac
gttgtgaaactgaacggcctaattcctggtactgaattcgaaggtaaaactctagaagag
atcatcaagacttctacaggcggtatcttcaacaacgcagcgcaagtatggaaccacact
ttctactggcactgtcttgctccaaacgcaggcggcgagccaacaggtgcagttgcagaa
gcgatcaacgcagcattcggttcattcgaagagttcaaagcaaaattcacggattcagca
atcaacaactttggttcatcttggacttggttggtgaagaaagcagacggttctctagca
atcgttaacacttcaaatgcggcaacaccaatcactgaagaaggcgtaactccactactg
actgtagacctatgggaacacgcttactacatcgattaccgcaacctacgtccagactac
atgaacggtttctgggcactggttaactgggatttcgttgcagagaacctagcgaaataa

DBGET integrated database retrieval system