KEGG   Vibrio vulnificus YJ016: VV1363Help
Entry
VV1363            CDS       T00150                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00240  Pyrimidine metabolism
vvy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    VV1363
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     VV1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: BAC94127
UniProt: Q7MLR4
LinkDB All DBs
Position
I:1388101..1388679
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRYGIGKVSSRIGLQAEAQ
LFKADTNLYQEIAALNEVEKRHCILVDECQFLSKEQVYQLTEVVDKLHIPVLCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGNAIKEGDQVAIGGNDRYVS
VCRQHYKEALGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggctcagatgtatttctattactcagcgatgaacgcgggtaaatcaacgactcttctt
cagtcttctttcaactatcaagagcgtggtatgacgcccgttatttttactgcagcttta
gatgatcgctatggtattggtaaagtcagctcacgaattggcttacaagctgaagcgcaa
ttgtttaaagcagacaccaatctctaccaagagatcgctgctctgaatgaagtggagaaa
cgccattgtattttggtggatgagtgccaattcttatcgaaagagcaagtgtatcagtta
acggaagtggtcgataagctgcacattcctgtattgtgttacggacttcgtacggatttt
cttggtgagctgtttgaaggcagcaaatacctcctttcttgggctgataaattggtcgag
ctaaaaaccatttgtcattgtggacgcaaagccaacatggttatccgcaccgacgagcat
ggcaacgcgattaaagaaggcgaccaagtggcgattggggggaacgatcgttacgtgtca
gtctgtcgtcaacactacaaagaagcgttgggtaaataa

DBGET integrated database retrieval system