KEGG   Vibrio vulnificus YJ016: VV1442Help
Entry
VV1442            CDS       T00150                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00250  Alanine, aspartate and glutamate metabolism
vvy00410  beta-Alanine metabolism
vvy00430  Taurine and hypotaurine metabolism
vvy00650  Butanoate metabolism
vvy01100  Metabolic pathways
vvy01110  Biosynthesis of secondary metabolites
vvy01120  Microbial metabolism in diverse environments
vvy02024  Quorum sensing
Module
vvy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vvy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VV1442
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VV1442
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VV1442
   00430 Taurine and hypotaurine metabolism
    VV1442
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    VV1442
Enzymes [BR:vvy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VV1442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS SHMT Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAC94206
UniProt: Q7MLI5
LinkDB All DBs
Position
I:complement(1475138..1476883)
Genome map
AA seq 581 aa AA seqDB search
MLIKTGHCSRFGLDCLARTTSIIKSICYMAMEQKTADVSFDSLLKIFTIPEGPDSTLTQI
EAKLSQNLNKFLGEHIVAEEKPLREIEKDFSSAQIPERPSFVSDHTEHLLNTLVSHSVHT
SSPSFIGHMTSALPYFLMPLSKIMIALNQNLVKIETSKAFTPLERQVLGMLHRLIYSQDE
AFYSHWMHSAEHSLGAFCSGGTIANITALWVARNNALRAQGDFKGVEKEGLFRAMKHYGY
EGLAVLVSERGHYSLKKAADVLGIGQAGLVAIKTDENNRVCPDALEAKIKELQAQNIKAF
AVIGVAGTTETGSVDPLAEMAKICQKYGCHFHVDAAWGGATLMSNKYRSLLDGVELADSV
TIDAHKQLYIPMGAGMVLFKDPNAMKSIEHHAQYILRKGSKDLGSHTLEGSRSGMAMLVY
ASMHIISRPGYELLINQSIEKAKYFADLIKQQDDFELISEPELCLLTYRYIPARVKQALA
AANAKQQLELNELLNELTKFTQKRQRETGRSFVSRTRLNPAQWSRMNTIVFRVVLANPLT
SFDILASVLEEQRNIIVHQAPNLLAKINKLADGIITSTQSS
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
ttgttaattaaaacgggacattgttcccgttttggtttagattgtctcgctcgaacgact
agtataattaaatcgatttgttatatggcaatggaacaaaaaaccgctgatgtcagcttt
gatagcctactgaagatcttcactatcccagagggtcctgattcaacactgactcaaatc
gaagcaaagctctcacaaaacttaaacaaattcctcggtgaacacatcgtggcagaagaa
aagcctttacgtgaaatcgagaaagacttttcttctgctcagatcccagagcgaccgtcc
tttgtctcagaccatactgagcacctactcaatactttggtatcgcactctgtgcataca
tcgtcacccagttttatcggtcatatgacttctgcgctcccatactttttgatgcctcta
tcaaaaatcatgattgcgctaaaccaaaacttggtaaaaatcgagacatccaaagccttt
acgccgctcgagcgtcaggttctaggtatgttacatcgcttaatttattcgcaagatgaa
gcgttttactctcattggatgcacagtgcagagcactccttaggtgcgttttgttcaggt
ggaaccatcgccaacatcacggccctttgggtagcacgtaacaatgcgttacgtgcgcaa
ggcgactttaaaggtgttgagaaagaagggcttttccgtgcgatgaaacactatggctac
gaagggcttgcggtgttggtttctgagcgtggtcattactcactaaaaaaagccgcggat
gttctaggtattggccaagcaggcttggtggccatcaaaaccgacgaaaacaatcgtgtt
tgtcccgatgctctcgaagcgaaaattaaagagttgcaagcgcaaaacatcaaagcattt
gccgtcatcggtgtagcagggacaacggagactggtagcgtcgatccattggcagaaatg
gcaaaaatttgccaaaaatatggctgtcatttccatgttgacgcggcttggggcggcgca
acattaatgtcaaacaagtatcgctccctactcgatggtgttgaacttgccgactctgtg
acgattgacgcgcataagcaactgtatatcccaatgggcgcaggaatggtgctattcaaa
gatcctaacgcaatgaaatcgatcgagcatcacgctcaatatattctgcggaaaggttct
aaagacttgggtagtcacacactagaaggttctcgttcaggcatggcaatgttggtttat
gccagcatgcatatcatcagccgccctggctacgagctgctcatcaatcaaagtattgaa
aaagcaaaatactttgctgatttgatcaaacagcaggatgattttgagctgatctccgaa
cctgagctttgtctgctcacctatcgctatatcccagctcgagtgaaacaagccttagct
gccgccaacgcaaaacagcaattagagctcaacgagctactgaatgaactcaccaagttc
actcaaaaacgccaacgtgagactggtcgctcatttgtatcgcgcacacgccttaacccc
gcacagtggtctcgcatgaacaccattgttttccgcgttgtgttggcaaacccactgacc
agctttgacatccttgcatccgtgttggaagaacaaagaaatatcattgttcatcaagcg
ccaaatctgttggcaaaaatcaacaagttagcagatggcattataaccagcactcagtcg
agctga

DBGET integrated database retrieval system